BLASTX nr result
ID: Mentha23_contig00039573
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00039573 (479 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006342894.1| PREDICTED: uncharacterized protein LOC102587... 58 2e-06 gb|EYU45918.1| hypothetical protein MIMGU_mgv1a017440mg [Mimulus... 55 8e-06 >ref|XP_006342894.1| PREDICTED: uncharacterized protein LOC102587783 [Solanum tuberosum] Length = 80 Score = 57.8 bits (138), Expect = 2e-06 Identities = 32/57 (56%), Positives = 38/57 (66%) Frame = -2 Query: 394 AEAARSLIEKRRLSTSTTELPSQSLEKLHEKEKNPYKKEKSSFRRVPPSRSNPTQNK 224 A AAR L K S T+ SQ+L+ LH K+K P+KK SSFRR+PPSR NP QNK Sbjct: 26 AYAARFLSNKDHPSQKTST--SQTLKGLHTKQKKPFKKVDSSFRRIPPSRWNPIQNK 80 >gb|EYU45918.1| hypothetical protein MIMGU_mgv1a017440mg [Mimulus guttatus] Length = 75 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/62 (48%), Positives = 35/62 (56%), Gaps = 2/62 (3%) Frame = +3 Query: 219 SYLFCVGFDLLGGTLLKLDFSFLYGFFSFSCNFSKDCEGSSVVEVDSRL--FSIRDLAAS 392 SYLFCVGFDLLGGT L+F Y S SC F +DCE + + F+ R L AS Sbjct: 14 SYLFCVGFDLLGGTFRALEFILSYRLLSLSCKFLRDCEENECTIFGDVIGAFATRGLIAS 73 Query: 393 AS 398 S Sbjct: 74 DS 75