BLASTX nr result
ID: Mentha23_contig00039453
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00039453 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19003.1| hypothetical protein MIMGU_mgv1a026720mg [Mimulus... 58 1e-06 gb|EYU19002.1| hypothetical protein MIMGU_mgv1a022328mg, partial... 58 1e-06 >gb|EYU19003.1| hypothetical protein MIMGU_mgv1a026720mg [Mimulus guttatus] Length = 435 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/70 (41%), Positives = 45/70 (64%) Frame = +3 Query: 6 YLSHGEILMHDWRGKFVIYNPITKEETHVCVLEDSRLDEDLRNDGVDDLQVVSHMPRLVR 185 Y+ + +ILMHDWR F++Y+ +T E+ + ED R DED V QVVSH+P ++ Sbjct: 359 YVENNKILMHDWRTNFLMYDVVTGSESVFPITEDIR-DEDGHRMAV---QVVSHVPNIIS 414 Query: 186 LKEALNVGEG 215 ++E LN+ +G Sbjct: 415 MRETLNIQQG 424 >gb|EYU19002.1| hypothetical protein MIMGU_mgv1a022328mg, partial [Mimulus guttatus] Length = 358 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/70 (41%), Positives = 45/70 (64%) Frame = +3 Query: 6 YLSHGEILMHDWRGKFVIYNPITKEETHVCVLEDSRLDEDLRNDGVDDLQVVSHMPRLVR 185 Y+ + +ILMHDWR F++Y+ +T E+ + ED R DED V QVVSH+P ++ Sbjct: 282 YVENNKILMHDWRTNFLMYDVVTGSESVFPITEDIR-DEDGHRMAV---QVVSHVPNIIS 337 Query: 186 LKEALNVGEG 215 ++E LN+ +G Sbjct: 338 MRETLNIQQG 347