BLASTX nr result
ID: Mentha23_contig00039373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00039373 (373 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22326.1| hypothetical protein MIMGU_mgv1a025822mg [Mimulus... 50 8e-07 >gb|EYU22326.1| hypothetical protein MIMGU_mgv1a025822mg [Mimulus guttatus] Length = 319 Score = 50.1 bits (118), Expect(2) = 8e-07 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 8/50 (16%) Frame = +1 Query: 121 KQKEHPQQGLCLSTSTADSGWFSSECGGSAAA--------DEETKTLVSS 246 K+K++ L LSTS+ADSGWFSSE GG+AAA +EET+TLVSS Sbjct: 133 KKKKNIPSRLRLSTSSADSGWFSSEGGGAAAAAAAGGQMDEEETETLVSS 182 Score = 28.5 bits (62), Expect(2) = 8e-07 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +3 Query: 273 AAAKCETPCGSRCSFAQISCTVGGKVKKSFTIV 371 AAA+ ET I CTV GKVK+SF +V Sbjct: 209 AAAEGETAARLSVFKKLIPCTVEGKVKESFAVV 241