BLASTX nr result
ID: Mentha23_contig00039194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00039194 (478 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46521.1| hypothetical protein MIMGU_mgv1a008855mg [Mimulus... 57 3e-06 >gb|EYU46521.1| hypothetical protein MIMGU_mgv1a008855mg [Mimulus guttatus] Length = 360 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/62 (48%), Positives = 40/62 (64%), Gaps = 2/62 (3%) Frame = +1 Query: 292 FTMQWLA--ILASIGALLCSAAHANHGVSDSCMMAYEEGGVPSILTSLECFPWLFSSLQS 465 FTM+ + I+ +G LLCS A A GVS SCM+AYEEGGV ++ +S EC W+ + S Sbjct: 5 FTMKRVVVVIVVFVGVLLCSIADAVRGVSVSCMVAYEEGGVRAVFSSPECPQWVLCAEPS 64 Query: 466 SN 471 N Sbjct: 65 KN 66