BLASTX nr result
ID: Mentha23_contig00039126
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00039126 (812 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003599571.1| Photosystem I assembly protein Ycf3 [Medicag... 136 8e-30 ref|XP_003620942.1| Photosystem I assembly protein Ycf3 [Medicag... 134 3e-29 ref|XP_003605620.1| Photosystem I assembly protein Ycf3 [Medicag... 133 9e-29 ref|XP_006841200.1| hypothetical protein AMTR_s00334p00015220 [A... 132 1e-28 emb|CCQ71621.1| photosystem I assembly protein Ycf3 (chloroplast... 110 8e-22 ref|YP_007507112.1| photosystem I assembly protein Ycf3 (chlorop... 110 8e-22 ref|YP_006503792.1| photosystem I assembly protein Ycf3 (chlorop... 107 4e-21 ref|YP_007353916.1| photosystem I assembly protein Ycf3 (chlorop... 107 7e-21 ref|YP_003359360.2| photosystem I assembly protein Ycf3 (chlorop... 107 7e-21 ref|YP_004376422.1| Ycf3 protein [Olea europaea subsp. europaea]... 107 7e-21 ref|YP_008999936.1| hypothetical chloroplast RF34 (chloroplast) ... 105 2e-20 ref|YP_005089335.1| ycf3 gene product (chloroplast) [Silene vulg... 105 2e-20 ref|YP_009000107.1| hypothetical chloroplast RF34 (chloroplast) ... 105 2e-20 gb|ABU85615.1| photosystem I assembly protein ycf3 [Scaevola aem... 105 2e-20 gb|AFB70727.1| photosystem I assembly protein Ycf3, partial (chl... 105 3e-20 ref|NP_054934.1| photosystem I assembly protein Ycf3 [Spinacia o... 104 3e-20 gb|AGW98376.1| hypothetical chloroplast RF34 (chloroplast) [Ipom... 104 3e-20 gb|AGW96677.1| hypothetical chloroplast RF34 (chloroplast) [Argy... 104 3e-20 gb|AEZ48758.1| photosystem I assembly protein Ycf3, partial [Apo... 104 3e-20 ref|YP_001468309.1| photosystem I assembly protein Ycf3 [Ipomoea... 104 3e-20 >ref|XP_003599571.1| Photosystem I assembly protein Ycf3 [Medicago truncatula] gi|355488619|gb|AES69822.1| Photosystem I assembly protein Ycf3 [Medicago truncatula] Length = 160 Score = 136 bits (343), Expect = 8e-30 Identities = 65/71 (91%), Positives = 66/71 (92%) Frame = -3 Query: 468 RMRQETLKYGSKGRN*STYSDRGEQAIHQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEA 289 RM QETLKYGSKGRN TYSDRGEQAI QGDSEIAE+WFDQAAEYWKQAIALTPGNYIEA Sbjct: 90 RMSQETLKYGSKGRNLLTYSDRGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEA 149 Query: 288 HNWLKITGRFE 256 NWLKITGRFE Sbjct: 150 QNWLKITGRFE 160 >ref|XP_003620942.1| Photosystem I assembly protein Ycf3 [Medicago truncatula] gi|355495957|gb|AES77160.1| Photosystem I assembly protein Ycf3 [Medicago truncatula] Length = 70 Score = 134 bits (338), Expect = 3e-29 Identities = 64/70 (91%), Positives = 65/70 (92%) Frame = -3 Query: 465 MRQETLKYGSKGRN*STYSDRGEQAIHQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAH 286 M QETLKYGSKGRN TYSDRGEQAI QGDSEIAE+WFDQAAEYWKQAIALTPGNYIEA Sbjct: 1 MSQETLKYGSKGRNLLTYSDRGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQ 60 Query: 285 NWLKITGRFE 256 NWLKITGRFE Sbjct: 61 NWLKITGRFE 70 >ref|XP_003605620.1| Photosystem I assembly protein Ycf3 [Medicago truncatula] gi|355506675|gb|AES87817.1| Photosystem I assembly protein Ycf3 [Medicago truncatula] Length = 201 Score = 133 bits (334), Expect = 9e-29 Identities = 64/71 (90%), Positives = 65/71 (91%) Frame = -3 Query: 468 RMRQETLKYGSKGRN*STYSDRGEQAIHQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEA 289 RM QETLKYGSKGRN T SDRGEQAI QGDSEIAE+WFDQAAEYWKQAIALTPGNYIEA Sbjct: 131 RMSQETLKYGSKGRNLLTNSDRGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEA 190 Query: 288 HNWLKITGRFE 256 NWLKITGRFE Sbjct: 191 QNWLKITGRFE 201 >ref|XP_006841200.1| hypothetical protein AMTR_s00334p00015220 [Amborella trichopoda] gi|548843107|gb|ERN02875.1| hypothetical protein AMTR_s00334p00015220 [Amborella trichopoda] Length = 70 Score = 132 bits (333), Expect = 1e-28 Identities = 63/70 (90%), Positives = 64/70 (91%) Frame = -3 Query: 465 MRQETLKYGSKGRN*STYSDRGEQAIHQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAH 286 MR ETLKYGSKGRN S YSDRGEQAI QGDSEIAEAWFDQAAEYWKQA+ALTPGNYIEA Sbjct: 1 MRSETLKYGSKGRNLSAYSDRGEQAIRQGDSEIAEAWFDQAAEYWKQALALTPGNYIEAQ 60 Query: 285 NWLKITGRFE 256 NWLKIT RFE Sbjct: 61 NWLKITRRFE 70 >emb|CCQ71621.1| photosystem I assembly protein Ycf3 (chloroplast) [Salvia miltiorrhiza] Length = 168 Score = 110 bits (274), Expect = 8e-22 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -3 Query: 405 RGEQAIHQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE 256 RGEQAIHQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE Sbjct: 119 RGEQAIHQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE 168 >ref|YP_007507112.1| photosystem I assembly protein Ycf3 (chloroplast) [Salvia miltiorrhiza] gi|401879743|gb|AFQ30930.1| photosystem I assembly protein Ycf3 (chloroplast) [Salvia miltiorrhiza] Length = 169 Score = 110 bits (274), Expect = 8e-22 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -3 Query: 405 RGEQAIHQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE 256 RGEQAIHQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE Sbjct: 120 RGEQAIHQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE 169 >ref|YP_006503792.1| photosystem I assembly protein Ycf3 (chloroplast) [Datura stramonium] gi|350996427|gb|AEQ36939.1| photosystem I assembly protein Ycf3 (chloroplast) [Datura stramonium] gi|350996579|gb|AEQ37090.1| photosystem I assembly protein Ycf3 [Datura stramonium] Length = 170 Score = 107 bits (268), Expect = 4e-21 Identities = 50/53 (94%), Positives = 50/53 (94%) Frame = -3 Query: 414 YSDRGEQAIHQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE 256 YS RGEQAI QGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKIT RFE Sbjct: 118 YSGRGEQAIQQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITRRFE 170 >ref|YP_007353916.1| photosystem I assembly protein Ycf3 (chloroplast) [Tectona grandis] gi|438687605|emb|CCP47131.1| photosystem I assembly protein Ycf3 (chloroplast) [Tectona grandis] gi|438688289|emb|CCP47220.1| photosystem I assembly protein Ycf3 (chloroplast) [Tectona grandis] gi|438688413|emb|CCP47309.1| photosystem I assembly protein Ycf3 (chloroplast) [Tectona grandis] Length = 169 Score = 107 bits (266), Expect = 7e-21 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = -3 Query: 405 RGEQAIHQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE 256 RGEQAI QGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE Sbjct: 120 RGEQAIRQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE 169 >ref|YP_003359360.2| photosystem I assembly protein Ycf3 (chloroplast) [Olea europaea] gi|363413086|gb|ADA69927.2| photosystem I assembly protein Ycf3 (chloroplast) [Olea europaea] Length = 167 Score = 107 bits (266), Expect = 7e-21 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = -3 Query: 405 RGEQAIHQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE 256 RGEQAI QGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE Sbjct: 118 RGEQAIRQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE 167 >ref|YP_004376422.1| Ycf3 protein [Olea europaea subsp. europaea] gi|334700283|ref|YP_004563782.1| Ycf3 protein [Olea europaea subsp. cuspidata] gi|334701620|ref|YP_004564005.1| Ycf3 protein [Olea woodiana subsp. woodiana] gi|334701889|ref|YP_004564498.1| Ycf3 protein [Olea europaea subsp. maroccana] gi|404474412|ref|YP_006665781.1| hypothetical chloroplast RF34 (chloroplast) [Elodea canadensis] gi|110456718|gb|ABG74821.1| YCF3 protein [Jasminum subhumile] gi|290488948|gb|ADD30858.1| putative RF3 protein [Ilex cornuta] gi|291059254|gb|ADD72090.1| hypothetical chloroplast RF34 [Olea europaea] gi|328795434|emb|CBR30316.1| Ycf3 protein [Olea europaea subsp. europaea] gi|334084402|emb|CBR23831.1| Ycf3 protein [Olea europaea subsp. cuspidata] gi|334084488|emb|CBR24622.1| Ycf3 protein [Olea europaea subsp. europaea] gi|334084574|emb|CBR30407.1| Ycf3 protein [Olea europaea subsp. europaea] gi|334084660|emb|CBS29351.1| Ycf3 protein [Olea woodiana subsp. woodiana] gi|334084865|emb|CBS29241.1| Ycf3 protein [Olea europaea subsp. maroccana] gi|334084951|emb|CBJ04299.1| Ycf3 protein [Olea europaea subsp. cuspidata] gi|334085037|emb|CBR23739.1| Ycf3 protein [Olea europaea subsp. cuspidata] gi|374094597|gb|AEY84653.1| hypothetical chloroplast RF34 (chloroplast) [Elodea canadensis] gi|510934405|emb|CCQ09103.1| Ycf3 protein (chloroplast) [Olea europaea subsp. europaea] Length = 168 Score = 107 bits (266), Expect = 7e-21 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = -3 Query: 405 RGEQAIHQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE 256 RGEQAI QGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE Sbjct: 119 RGEQAIRQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE 168 >ref|YP_008999936.1| hypothetical chloroplast RF34 (chloroplast) [Agrostemma githago] gi|576312302|ref|YP_009000186.1| hypothetical chloroplast RF34 (chloroplast) [Silene paradoxa] gi|555944022|gb|AGZ17926.1| hypothetical chloroplast RF34 (chloroplast) [Agrostemma githago] gi|555944275|gb|AGZ18176.1| hypothetical chloroplast RF34 (chloroplast) [Silene paradoxa] Length = 168 Score = 105 bits (262), Expect = 2e-20 Identities = 48/50 (96%), Positives = 48/50 (96%) Frame = -3 Query: 405 RGEQAIHQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE 256 RGEQAI QGDSEIAEAWFDQAAEYWKQAI LTPGNYIEAHNWLKITGRFE Sbjct: 119 RGEQAIRQGDSEIAEAWFDQAAEYWKQAITLTPGNYIEAHNWLKITGRFE 168 >ref|YP_005089335.1| ycf3 gene product (chloroplast) [Silene vulgaris] gi|374249789|ref|YP_005089418.1| ycf3 gene product (chloroplast) [Silene noctiflora] gi|374249878|ref|YP_005089506.1| ycf3 gene product (chloroplast) [Silene conica] gi|374249951|ref|YP_005089578.1| ycf3 gene product (chloroplast) [Silene latifolia] gi|575925640|ref|YP_009000025.1| hypothetical chloroplast RF34 (chloroplast) [Silene conoidea] gi|329755449|gb|AEC04013.1| hypothetical chloroplast RF34 (chloroplast) [Silene conica] gi|329755522|gb|AEC04085.1| hypothetical chloroplast RF34 (chloroplast) [Silene latifolia] gi|329755606|gb|AEC04168.1| hypothetical chloroplast RF34 (chloroplast) [Silene noctiflora] gi|329755687|gb|AEC04248.1| hypothetical chloroplast RF34 (chloroplast) [Silene vulgaris] gi|555944112|gb|AGZ18015.1| hypothetical chloroplast RF34 (chloroplast) [Silene conoidea] Length = 168 Score = 105 bits (262), Expect = 2e-20 Identities = 48/50 (96%), Positives = 48/50 (96%) Frame = -3 Query: 405 RGEQAIHQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE 256 RGEQAI QGDSEIAEAWFDQAAEYWKQAI LTPGNYIEAHNWLKITGRFE Sbjct: 119 RGEQAIRQGDSEIAEAWFDQAAEYWKQAITLTPGNYIEAHNWLKITGRFE 168 >ref|YP_009000107.1| hypothetical chloroplast RF34 (chloroplast) [Silene chalcedonica] gi|166235536|gb|ABY85451.1| ycf3 protein [Silene chalcedonica] gi|555944195|gb|AGZ18097.1| hypothetical chloroplast RF34 (chloroplast) [Silene chalcedonica] Length = 168 Score = 105 bits (262), Expect = 2e-20 Identities = 48/50 (96%), Positives = 48/50 (96%) Frame = -3 Query: 405 RGEQAIHQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE 256 RGEQAI QGDSEIAEAWFDQAAEYWKQAI LTPGNYIEAHNWLKITGRFE Sbjct: 119 RGEQAIRQGDSEIAEAWFDQAAEYWKQAITLTPGNYIEAHNWLKITGRFE 168 >gb|ABU85615.1| photosystem I assembly protein ycf3 [Scaevola aemula] Length = 168 Score = 105 bits (262), Expect = 2e-20 Identities = 48/50 (96%), Positives = 48/50 (96%) Frame = -3 Query: 405 RGEQAIHQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE 256 RGEQAI QGDSEIAEAWFDQAAEYWKQAI LTPGNYIEAHNWLKITGRFE Sbjct: 119 RGEQAIRQGDSEIAEAWFDQAAEYWKQAITLTPGNYIEAHNWLKITGRFE 168 >gb|AFB70727.1| photosystem I assembly protein Ycf3, partial (chloroplast) [Mollugo verticillata] Length = 217 Score = 105 bits (261), Expect = 3e-20 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = -3 Query: 405 RGEQAIHQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE 256 RGEQAI QGDSE+AEAWFDQAAEYWKQAI LTPGNYIEAHNWLKITGRFE Sbjct: 168 RGEQAIRQGDSEVAEAWFDQAAEYWKQAITLTPGNYIEAHNWLKITGRFE 217 >ref|NP_054934.1| photosystem I assembly protein Ycf3 [Spinacia oleracea] gi|18203267|sp|Q9M3M5.1|YCF3_SPIOL RecName: Full=Photosystem I assembly protein Ycf3 gi|7636107|emb|CAB88727.1| ycf3 protein [Spinacia oleracea] Length = 165 Score = 104 bits (260), Expect = 3e-20 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = -3 Query: 405 RGEQAIHQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE 256 RGEQAI QGDSEIAEAWFDQAAEYWKQA+ LTPGNYIEAHNWLKITGRFE Sbjct: 116 RGEQAIRQGDSEIAEAWFDQAAEYWKQALTLTPGNYIEAHNWLKITGRFE 165 >gb|AGW98376.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea cordatotriloba] Length = 168 Score = 104 bits (260), Expect = 3e-20 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = -3 Query: 405 RGEQAIHQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE 256 RGEQAI QGDSE+AE WFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE Sbjct: 119 RGEQAIQQGDSELAETWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE 168 >gb|AGW96677.1| hypothetical chloroplast RF34 (chloroplast) [Argyreia nervosa] Length = 168 Score = 104 bits (260), Expect = 3e-20 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = -3 Query: 405 RGEQAIHQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE 256 RGEQAI QGDSE+AE WFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE Sbjct: 119 RGEQAIQQGDSELAETWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE 168 >gb|AEZ48758.1| photosystem I assembly protein Ycf3, partial [Apostasia wallichii] Length = 168 Score = 104 bits (260), Expect = 3e-20 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = -3 Query: 405 RGEQAIHQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE 256 RGEQAI QGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRF+ Sbjct: 119 RGEQAILQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFD 168 >ref|YP_001468309.1| photosystem I assembly protein Ycf3 [Ipomoea purpurea] gi|171769949|sp|A7Y3D6.1|YCF3_IPOPU RecName: Full=Photosystem I assembly protein Ycf3 gi|157056759|gb|ABV02349.1| hypothetical chloroplast RF34 [Ipomoea purpurea] gi|546352431|gb|AGW96338.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea batatas] gi|546352517|gb|AGW96423.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea batatas] gi|546352603|gb|AGW96508.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea batatas] gi|546352689|gb|AGW96593.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea trifida] gi|546352860|gb|AGW96762.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea amnicola] gi|546352946|gb|AGW96847.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea argillicola] gi|546353032|gb|AGW96932.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea cairica] gi|546353118|gb|AGW97017.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea diamantinensis] gi|546353204|gb|AGW97102.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea dumetorum] gi|546353290|gb|AGW97187.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea eriocarpa] gi|546353376|gb|AGW97272.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea hederifolia] gi|546353462|gb|AGW97357.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea involucrata] gi|546353548|gb|AGW97442.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea murucoides] gi|546353634|gb|AGW97527.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea nil] gi|546353720|gb|AGW97612.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea orizabensis] gi|546353806|gb|AGW97697.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea pedicellaris] gi|546353892|gb|AGW97782.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea pes-caprae] gi|546353978|gb|AGW97867.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea polpha] gi|546354064|gb|AGW97952.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea setosa] gi|546354149|gb|AGW98036.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea splendor-sylvae] gi|546354235|gb|AGW98121.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea ternifolia] gi|546354321|gb|AGW98206.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea tricolor] gi|546354407|gb|AGW98291.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea trifida] gi|546354579|gb|AGW98461.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea minutiflora] gi|546354665|gb|AGW98546.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea obscura] gi|546354751|gb|AGW98631.1| hypothetical chloroplast RF34 (chloroplast) [Ipomoea pes-tigridis] gi|546354837|gb|AGW98716.1| hypothetical chloroplast RF34 (chloroplast) [Merremia quinquefolia] gi|546354923|gb|AGW98801.1| hypothetical chloroplast RF34 (chloroplast) [Operculina macrocarpa] gi|546355009|gb|AGW98886.1| hypothetical chloroplast RF34 (chloroplast) [Stictocardia macalusoi] gi|546355095|gb|AGW98971.1| hypothetical chloroplast RF34 (chloroplast) [Turbina corymbosa] Length = 168 Score = 104 bits (260), Expect = 3e-20 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = -3 Query: 405 RGEQAIHQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE 256 RGEQAI QGDSE+AE WFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE Sbjct: 119 RGEQAIQQGDSELAETWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRFE 168