BLASTX nr result
ID: Mentha23_contig00038895
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00038895 (307 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32975.1| hypothetical protein MIMGU_mgv1a024873mg, partial... 69 9e-10 ref|XP_004234234.1| PREDICTED: putative SWI/SNF-related matrix-a... 64 3e-08 ref|XP_006356106.1| PREDICTED: putative SWI/SNF-related matrix-a... 63 4e-08 emb|CBI23583.3| unnamed protein product [Vitis vinifera] 60 4e-07 ref|XP_002280814.1| PREDICTED: putative SWI/SNF-related matrix-a... 60 4e-07 emb|CAN71217.1| hypothetical protein VITISV_033485 [Vitis vinifera] 59 5e-07 ref|XP_006600435.1| PREDICTED: putative SWI/SNF-related matrix-a... 58 1e-06 ref|XP_006592736.1| PREDICTED: putative SWI/SNF-related matrix-a... 58 1e-06 ref|XP_006592735.1| PREDICTED: putative SWI/SNF-related matrix-a... 58 1e-06 ref|XP_007035047.1| Helicase protein with RING/U-box domain [The... 58 1e-06 ref|XP_007225447.1| hypothetical protein PRUPE_ppa000367mg [Prun... 58 1e-06 ref|XP_007150115.1| hypothetical protein PHAVU_005G128000g [Phas... 58 2e-06 ref|XP_004487538.1| PREDICTED: putative SWI/SNF-related matrix-a... 58 2e-06 ref|XP_004487537.1| PREDICTED: putative SWI/SNF-related matrix-a... 58 2e-06 ref|XP_004487536.1| PREDICTED: putative SWI/SNF-related matrix-a... 58 2e-06 ref|XP_004134418.1| PREDICTED: putative SWI/SNF-related matrix-a... 58 2e-06 ref|XP_004297995.1| PREDICTED: putative SWI/SNF-related matrix-a... 57 3e-06 ref|XP_002529311.1| DNA repair helicase rad5,16, putative [Ricin... 57 3e-06 ref|XP_006279560.1| hypothetical protein CARUB_v10025760mg [Caps... 57 3e-06 ref|XP_004251374.1| PREDICTED: putative SWI/SNF-related matrix-a... 57 3e-06 >gb|EYU32975.1| hypothetical protein MIMGU_mgv1a024873mg, partial [Mimulus guttatus] Length = 1245 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +2 Query: 119 KEMEPSDNLACHLRPYQEQALYWMSEVEKGANHEEKEKTLH 241 +EMEP + L C LRPYQ+QALYWM+E+E+GAN EE EKTLH Sbjct: 578 EEMEPPETLTCELRPYQKQALYWMTELERGANGEETEKTLH 618 >ref|XP_004234234.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3-like [Solanum lycopersicum] Length = 1120 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = +2 Query: 119 KEMEPSDNLACHLRPYQEQALYWMSEVEKGANHEEKEKTLH 241 KEME D L C LRPYQ++ALYWMSE EKGA EE KTLH Sbjct: 449 KEMEAPDTLVCSLRPYQKEALYWMSESEKGAGVEEASKTLH 489 >ref|XP_006356106.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3-like [Solanum tuberosum] Length = 1138 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = +2 Query: 119 KEMEPSDNLACHLRPYQEQALYWMSEVEKGANHEEKEKTLH 241 KEME D L C LRPYQ++ALYWMSE EKGA EE KTLH Sbjct: 467 KEMEAPDTLMCSLRPYQKEALYWMSESEKGAGVEEASKTLH 507 >emb|CBI23583.3| unnamed protein product [Vitis vinifera] Length = 1287 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = +2 Query: 119 KEMEPSDNLACHLRPYQEQALYWMSEVEKGANHEEKEKTLH 241 +EME L C LRPYQ+QALYWMSE+EKG++ E+ KTLH Sbjct: 548 EEMESPSTLMCDLRPYQKQALYWMSELEKGSDAEQAPKTLH 588 >ref|XP_002280814.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3-like [Vitis vinifera] Length = 1224 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = +2 Query: 119 KEMEPSDNLACHLRPYQEQALYWMSEVEKGANHEEKEKTLH 241 +EME L C LRPYQ+QALYWMSE+EKG++ E+ KTLH Sbjct: 548 EEMESPSTLMCDLRPYQKQALYWMSELEKGSDAEQAPKTLH 588 >emb|CAN71217.1| hypothetical protein VITISV_033485 [Vitis vinifera] Length = 1249 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = +2 Query: 119 KEMEPSDNLACHLRPYQEQALYWMSEVEKGANHEEKEKTLH 241 +EME + C LRPYQ+QALYWMSE+EKG++ E+ KTLH Sbjct: 548 EEMESPSTJMCDLRPYQKQALYWMSELEKGSDAEQAPKTLH 588 >ref|XP_006600435.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like [Glycine max] Length = 1029 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = +2 Query: 104 SSVLCKEMEPSDNLACHLRPYQEQALYWMSEVEKGANHEEKEKTLH 241 SS +EM+P NL C LRPYQ+QALYWM ++EKG + +E TLH Sbjct: 330 SSSELEEMDPPGNLMCELRPYQKQALYWMIQMEKGQSMDETATTLH 375 >ref|XP_006592736.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like isoform X2 [Glycine max] Length = 1003 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = +2 Query: 104 SSVLCKEMEPSDNLACHLRPYQEQALYWMSEVEKGANHEEKEKTLH 241 SS +EM+P NL C LRPYQ+QALYWM ++EKG + +E TLH Sbjct: 304 SSSELEEMDPPGNLMCELRPYQKQALYWMIQMEKGQSMDETATTLH 349 >ref|XP_006592735.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like isoform X1 [Glycine max] Length = 1012 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = +2 Query: 104 SSVLCKEMEPSDNLACHLRPYQEQALYWMSEVEKGANHEEKEKTLH 241 SS +EM+P NL C LRPYQ+QALYWM ++EKG + +E TLH Sbjct: 304 SSSELEEMDPPGNLMCELRPYQKQALYWMIQMEKGQSMDETATTLH 349 >ref|XP_007035047.1| Helicase protein with RING/U-box domain [Theobroma cacao] gi|508714076|gb|EOY05973.1| Helicase protein with RING/U-box domain [Theobroma cacao] Length = 1125 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +2 Query: 119 KEMEPSDNLACHLRPYQEQALYWMSEVEKGANHEEKEKTLH 241 +EMEP L C LRPYQ+QALYWMSE EKG + E+ +TLH Sbjct: 449 EEMEPPYTLTCDLRPYQKQALYWMSESEKGIDAEKAAQTLH 489 >ref|XP_007225447.1| hypothetical protein PRUPE_ppa000367mg [Prunus persica] gi|462422383|gb|EMJ26646.1| hypothetical protein PRUPE_ppa000367mg [Prunus persica] Length = 1241 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = +2 Query: 119 KEMEPSDNLACHLRPYQEQALYWMSEVEKGANHEEKEKTLH 241 +EMEP L C L+PYQ+QALYWMSE+EKG + E+ +TLH Sbjct: 537 EEMEPPSTLTCVLKPYQKQALYWMSELEKGIDVEKATQTLH 577 >ref|XP_007150115.1| hypothetical protein PHAVU_005G128000g [Phaseolus vulgaris] gi|561023379|gb|ESW22109.1| hypothetical protein PHAVU_005G128000g [Phaseolus vulgaris] Length = 1000 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = +2 Query: 104 SSVLCKEMEPSDNLACHLRPYQEQALYWMSEVEKGANHEEKEKTLH 241 SS +EMEP NL C LRPYQ+QALYWM ++EKG +E TLH Sbjct: 301 SSAELEEMEPPANLQCDLRPYQKQALYWMIQMEKGQCMDETATTLH 346 >ref|XP_004487538.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like isoform X3 [Cicer arietinum] Length = 864 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/46 (56%), Positives = 32/46 (69%) Frame = +2 Query: 104 SSVLCKEMEPSDNLACHLRPYQEQALYWMSEVEKGANHEEKEKTLH 241 SS +EM+P NL C LRPYQ+QALYWM ++EKG +E TLH Sbjct: 163 SSSELEEMDPPGNLLCELRPYQKQALYWMVQMEKGRPRDETATTLH 208 >ref|XP_004487537.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like isoform X2 [Cicer arietinum] Length = 1012 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/46 (56%), Positives = 32/46 (69%) Frame = +2 Query: 104 SSVLCKEMEPSDNLACHLRPYQEQALYWMSEVEKGANHEEKEKTLH 241 SS +EM+P NL C LRPYQ+QALYWM ++EKG +E TLH Sbjct: 311 SSSELEEMDPPGNLLCELRPYQKQALYWMVQMEKGRPRDETATTLH 356 >ref|XP_004487536.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like isoform X1 [Cicer arietinum] Length = 1006 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/46 (56%), Positives = 32/46 (69%) Frame = +2 Query: 104 SSVLCKEMEPSDNLACHLRPYQEQALYWMSEVEKGANHEEKEKTLH 241 SS +EM+P NL C LRPYQ+QALYWM ++EKG +E TLH Sbjct: 305 SSSELEEMDPPGNLLCELRPYQKQALYWMVQMEKGRPRDETATTLH 350 >ref|XP_004134418.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3-like [Cucumis sativus] gi|449523563|ref|XP_004168793.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3-like [Cucumis sativus] Length = 1113 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = +2 Query: 122 EMEPSDNLACHLRPYQEQALYWMSEVEKGANHEEKEKTLH 241 EMEP L C LRPYQ+QAL+WMSE+EKG + E+ +TLH Sbjct: 444 EMEPPPTLTCDLRPYQKQALFWMSELEKGIDVEKAAQTLH 483 >ref|XP_004297995.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3-like [Fragaria vesca subsp. vesca] Length = 1231 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = +2 Query: 119 KEMEPSDNLACHLRPYQEQALYWMSEVEKGANHEEKEKTLH 241 +EMEP L C L+PYQ+QALYWMSE+EKG + E+ +K LH Sbjct: 564 EEMEPPCTLRCVLKPYQKQALYWMSELEKGIDVEKAQKMLH 604 >ref|XP_002529311.1| DNA repair helicase rad5,16, putative [Ricinus communis] gi|223531235|gb|EEF33080.1| DNA repair helicase rad5,16, putative [Ricinus communis] Length = 1051 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = +2 Query: 119 KEMEPSDNLACHLRPYQEQALYWMSEVEKGANHEEKEKTLH 241 +EMEP L C LR YQ+QALYWMSE EKG + E+ KTLH Sbjct: 394 EEMEPPHTLMCSLRSYQKQALYWMSECEKGIDVEKAAKTLH 434 >ref|XP_006279560.1| hypothetical protein CARUB_v10025760mg [Capsella rubella] gi|482548264|gb|EOA12458.1| hypothetical protein CARUB_v10025760mg [Capsella rubella] Length = 1196 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = +2 Query: 119 KEMEPSDNLACHLRPYQEQALYWMSEVEKGANHEEKEKTLH 241 +EME L C+LRPYQ+QALYWMSE EKG + E+ +TLH Sbjct: 547 EEMEAPSTLTCNLRPYQKQALYWMSESEKGIDVEKAAETLH 587 >ref|XP_004251374.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like [Solanum lycopersicum] Length = 1015 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = +2 Query: 119 KEMEPSDNLACHLRPYQEQALYWMSEVEKGANHEEKEKTLH 241 +EMEP L C LRPYQ+QAL+WM+++E+G N +E TLH Sbjct: 337 QEMEPPSTLQCELRPYQKQALHWMTQLERGRNTDEAATTLH 377