BLASTX nr result
ID: Mentha23_contig00038826
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00038826 (407 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS65108.1| hypothetical protein M569_09667 [Genlisea aurea] 93 3e-17 ref|XP_004500762.1| PREDICTED: tRNA-dihydrouridine(47) synthase ... 93 4e-17 ref|XP_002513011.1| tRNA-dihydrouridine synthase, putative [Rici... 93 4e-17 ref|XP_007042005.1| FMN-linked oxidoreductases superfamily prote... 92 1e-16 ref|XP_007042002.1| FMN-linked oxidoreductases superfamily prote... 92 1e-16 ref|XP_002313751.2| hypothetical protein POPTR_0009s12840g [Popu... 91 1e-16 ref|XP_003604013.1| tRNA-dihydrouridine synthase 3-like protein ... 91 1e-16 gb|EXB61816.1| tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like... 91 2e-16 ref|XP_006487271.1| PREDICTED: tRNA-dihydrouridine(47) synthase ... 91 2e-16 ref|XP_006487270.1| PREDICTED: tRNA-dihydrouridine(47) synthase ... 91 2e-16 gb|AFW57891.1| hypothetical protein ZEAMMB73_676116 [Zea mays] 91 2e-16 gb|AFW57889.1| hypothetical protein ZEAMMB73_676116 [Zea mays] 91 2e-16 ref|XP_002446053.1| hypothetical protein SORBIDRAFT_06g001050 [S... 91 2e-16 ref|NP_001145737.1| uncharacterized protein LOC100279244 [Zea ma... 91 2e-16 ref|XP_004975016.1| PREDICTED: tRNA-dihydrouridine(47) synthase ... 90 3e-16 ref|XP_006359609.1| PREDICTED: tRNA-dihydrouridine(47) synthase ... 90 4e-16 ref|XP_004290298.1| PREDICTED: tRNA-dihydrouridine(47) synthase ... 90 4e-16 ref|XP_001777304.1| predicted protein [Physcomitrella patens] gi... 90 4e-16 gb|EYU37914.1| hypothetical protein MIMGU_mgv1a002380mg [Mimulus... 89 5e-16 ref|XP_003580470.1| PREDICTED: tRNA-dihydrouridine synthase 3-li... 89 5e-16 >gb|EPS65108.1| hypothetical protein M569_09667 [Genlisea aurea] Length = 726 Score = 93.2 bits (230), Expect = 3e-17 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -3 Query: 405 CRYIPVGLLDVIPQKINWRPPSYFGRDDLETLMASESAADWIRLT 271 CRYIPV LLDVIPQKINWRPPSYFGRDD+ETLMASESAADWIR++ Sbjct: 654 CRYIPVSLLDVIPQKINWRPPSYFGRDDMETLMASESAADWIRIS 698 >ref|XP_004500762.1| PREDICTED: tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like [Cicer arietinum] Length = 702 Score = 92.8 bits (229), Expect = 4e-17 Identities = 39/45 (86%), Positives = 45/45 (100%) Frame = -3 Query: 405 CRYIPVGLLDVIPQKINWRPPSYFGRDDLETLMASESAADWIRLT 271 CRYIPVGLLDV+PQ+INWRPPSY+GRDDLETLMAS+SAADW+RL+ Sbjct: 630 CRYIPVGLLDVVPQRINWRPPSYYGRDDLETLMASDSAADWVRLS 674 >ref|XP_002513011.1| tRNA-dihydrouridine synthase, putative [Ricinus communis] gi|223548022|gb|EEF49514.1| tRNA-dihydrouridine synthase, putative [Ricinus communis] Length = 686 Score = 92.8 bits (229), Expect = 4e-17 Identities = 40/45 (88%), Positives = 45/45 (100%) Frame = -3 Query: 405 CRYIPVGLLDVIPQKINWRPPSYFGRDDLETLMASESAADWIRLT 271 CRYIPVGLLDVIPQ+INWRPPSY+GRDDLETLMAS+SAADWIR++ Sbjct: 614 CRYIPVGLLDVIPQRINWRPPSYYGRDDLETLMASDSAADWIRIS 658 >ref|XP_007042005.1| FMN-linked oxidoreductases superfamily protein isoform 4 [Theobroma cacao] gi|508705940|gb|EOX97836.1| FMN-linked oxidoreductases superfamily protein isoform 4 [Theobroma cacao] Length = 561 Score = 91.7 bits (226), Expect = 1e-16 Identities = 38/45 (84%), Positives = 45/45 (100%) Frame = -3 Query: 405 CRYIPVGLLDVIPQKINWRPPSYFGRDDLETLMASESAADWIRLT 271 CRYIPVGLLDVIPQ++NWRPPSY+GRDDLETLMAS+SAADW+R++ Sbjct: 489 CRYIPVGLLDVIPQRLNWRPPSYYGRDDLETLMASDSAADWVRIS 533 >ref|XP_007042002.1| FMN-linked oxidoreductases superfamily protein isoform 1 [Theobroma cacao] gi|508705937|gb|EOX97833.1| FMN-linked oxidoreductases superfamily protein isoform 1 [Theobroma cacao] Length = 699 Score = 91.7 bits (226), Expect = 1e-16 Identities = 38/45 (84%), Positives = 45/45 (100%) Frame = -3 Query: 405 CRYIPVGLLDVIPQKINWRPPSYFGRDDLETLMASESAADWIRLT 271 CRYIPVGLLDVIPQ++NWRPPSY+GRDDLETLMAS+SAADW+R++ Sbjct: 627 CRYIPVGLLDVIPQRLNWRPPSYYGRDDLETLMASDSAADWVRIS 671 >ref|XP_002313751.2| hypothetical protein POPTR_0009s12840g [Populus trichocarpa] gi|550331612|gb|EEE87706.2| hypothetical protein POPTR_0009s12840g [Populus trichocarpa] Length = 704 Score = 91.3 bits (225), Expect = 1e-16 Identities = 37/45 (82%), Positives = 45/45 (100%) Frame = -3 Query: 405 CRYIPVGLLDVIPQKINWRPPSYFGRDDLETLMASESAADWIRLT 271 CRY+PVGLLDVIPQ++NWRPPSY+GRDDLETLMAS+SAADW+R++ Sbjct: 632 CRYVPVGLLDVIPQRLNWRPPSYYGRDDLETLMASDSAADWVRIS 676 >ref|XP_003604013.1| tRNA-dihydrouridine synthase 3-like protein [Medicago truncatula] gi|355493061|gb|AES74264.1| tRNA-dihydrouridine synthase 3-like protein [Medicago truncatula] Length = 691 Score = 91.3 bits (225), Expect = 1e-16 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = -3 Query: 405 CRYIPVGLLDVIPQKINWRPPSYFGRDDLETLMASESAADWIRLT 271 CRYIPVGLLDV+PQ+INWRPPSY GRDDLETLMAS+SAADW+RL+ Sbjct: 619 CRYIPVGLLDVVPQRINWRPPSYHGRDDLETLMASDSAADWVRLS 663 >gb|EXB61816.1| tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like protein [Morus notabilis] Length = 692 Score = 90.9 bits (224), Expect = 2e-16 Identities = 37/45 (82%), Positives = 45/45 (100%) Frame = -3 Query: 405 CRYIPVGLLDVIPQKINWRPPSYFGRDDLETLMASESAADWIRLT 271 CRYIPVGLLD+IPQ++NWRPPSY+GRDDLETLMAS+SAADW+R++ Sbjct: 620 CRYIPVGLLDIIPQRLNWRPPSYYGRDDLETLMASDSAADWLRIS 664 >ref|XP_006487271.1| PREDICTED: tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like isoform X2 [Citrus sinensis] Length = 693 Score = 90.9 bits (224), Expect = 2e-16 Identities = 38/45 (84%), Positives = 45/45 (100%) Frame = -3 Query: 405 CRYIPVGLLDVIPQKINWRPPSYFGRDDLETLMASESAADWIRLT 271 CRYIPVGLLDVIPQ++NWRPP+Y+GRDDLETLMAS+SAADWIR++ Sbjct: 621 CRYIPVGLLDVIPQRLNWRPPAYYGRDDLETLMASDSAADWIRIS 665 >ref|XP_006487270.1| PREDICTED: tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like isoform X1 [Citrus sinensis] Length = 694 Score = 90.9 bits (224), Expect = 2e-16 Identities = 38/45 (84%), Positives = 45/45 (100%) Frame = -3 Query: 405 CRYIPVGLLDVIPQKINWRPPSYFGRDDLETLMASESAADWIRLT 271 CRYIPVGLLDVIPQ++NWRPP+Y+GRDDLETLMAS+SAADWIR++ Sbjct: 622 CRYIPVGLLDVIPQRLNWRPPAYYGRDDLETLMASDSAADWIRIS 666 >gb|AFW57891.1| hypothetical protein ZEAMMB73_676116 [Zea mays] Length = 145 Score = 90.5 bits (223), Expect = 2e-16 Identities = 38/45 (84%), Positives = 44/45 (97%) Frame = -3 Query: 405 CRYIPVGLLDVIPQKINWRPPSYFGRDDLETLMASESAADWIRLT 271 CRYIPVGLLDVIPQ++NWRPPSY+GRDDLETLM S+SAADWIR++ Sbjct: 73 CRYIPVGLLDVIPQRLNWRPPSYYGRDDLETLMVSDSAADWIRIS 117 >gb|AFW57889.1| hypothetical protein ZEAMMB73_676116 [Zea mays] Length = 264 Score = 90.5 bits (223), Expect = 2e-16 Identities = 38/45 (84%), Positives = 44/45 (97%) Frame = -3 Query: 405 CRYIPVGLLDVIPQKINWRPPSYFGRDDLETLMASESAADWIRLT 271 CRYIPVGLLDVIPQ++NWRPPSY+GRDDLETLM S+SAADWIR++ Sbjct: 192 CRYIPVGLLDVIPQRLNWRPPSYYGRDDLETLMVSDSAADWIRIS 236 >ref|XP_002446053.1| hypothetical protein SORBIDRAFT_06g001050 [Sorghum bicolor] gi|241937236|gb|EES10381.1| hypothetical protein SORBIDRAFT_06g001050 [Sorghum bicolor] Length = 679 Score = 90.5 bits (223), Expect = 2e-16 Identities = 38/45 (84%), Positives = 44/45 (97%) Frame = -3 Query: 405 CRYIPVGLLDVIPQKINWRPPSYFGRDDLETLMASESAADWIRLT 271 CRYIPVGLLDVIPQ++NWRPPSY+GRDDLETLM S+SAADWIR++ Sbjct: 607 CRYIPVGLLDVIPQRLNWRPPSYYGRDDLETLMVSDSAADWIRIS 651 >ref|NP_001145737.1| uncharacterized protein LOC100279244 [Zea mays] gi|219884231|gb|ACL52490.1| unknown [Zea mays] gi|224031411|gb|ACN34781.1| unknown [Zea mays] gi|413917958|gb|AFW57890.1| hypothetical protein ZEAMMB73_676116 [Zea mays] Length = 686 Score = 90.5 bits (223), Expect = 2e-16 Identities = 38/45 (84%), Positives = 44/45 (97%) Frame = -3 Query: 405 CRYIPVGLLDVIPQKINWRPPSYFGRDDLETLMASESAADWIRLT 271 CRYIPVGLLDVIPQ++NWRPPSY+GRDDLETLM S+SAADWIR++ Sbjct: 614 CRYIPVGLLDVIPQRLNWRPPSYYGRDDLETLMVSDSAADWIRIS 658 >ref|XP_004975016.1| PREDICTED: tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like [Setaria italica] Length = 680 Score = 90.1 bits (222), Expect = 3e-16 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = -3 Query: 405 CRYIPVGLLDVIPQKINWRPPSYFGRDDLETLMASESAADWIRLT 271 CRYIPVGLLDVIPQ++NWRPPSY GRDDLETLMAS+SAADWIR++ Sbjct: 608 CRYIPVGLLDVIPQRLNWRPPSYCGRDDLETLMASDSAADWIRIS 652 >ref|XP_006359609.1| PREDICTED: tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like [Solanum tuberosum] Length = 702 Score = 89.7 bits (221), Expect = 4e-16 Identities = 37/45 (82%), Positives = 44/45 (97%) Frame = -3 Query: 405 CRYIPVGLLDVIPQKINWRPPSYFGRDDLETLMASESAADWIRLT 271 CRY+PVGLLD+IPQKINWR PSY+GRDDLETLMAS+SAADW+R++ Sbjct: 630 CRYVPVGLLDIIPQKINWRSPSYYGRDDLETLMASDSAADWVRIS 674 >ref|XP_004290298.1| PREDICTED: tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like [Fragaria vesca subsp. vesca] Length = 699 Score = 89.7 bits (221), Expect = 4e-16 Identities = 37/45 (82%), Positives = 44/45 (97%) Frame = -3 Query: 405 CRYIPVGLLDVIPQKINWRPPSYFGRDDLETLMASESAADWIRLT 271 CRY+PVGLLDVIPQ+++WRPPSYFGRDDLETLM S+SAADW+RL+ Sbjct: 627 CRYVPVGLLDVIPQRLSWRPPSYFGRDDLETLMGSDSAADWVRLS 671 >ref|XP_001777304.1| predicted protein [Physcomitrella patens] gi|162671280|gb|EDQ57834.1| predicted protein [Physcomitrella patens] Length = 266 Score = 89.7 bits (221), Expect = 4e-16 Identities = 39/44 (88%), Positives = 44/44 (100%) Frame = -3 Query: 402 RYIPVGLLDVIPQKINWRPPSYFGRDDLETLMASESAADWIRLT 271 RYIPVGLLDVIPQK+NWRPP+YFGR+DLETLMAS+SAADW+RLT Sbjct: 195 RYIPVGLLDVIPQKLNWRPPNYFGRNDLETLMASDSAADWVRLT 238 >gb|EYU37914.1| hypothetical protein MIMGU_mgv1a002380mg [Mimulus guttatus] Length = 681 Score = 89.4 bits (220), Expect = 5e-16 Identities = 39/44 (88%), Positives = 44/44 (100%) Frame = -3 Query: 402 RYIPVGLLDVIPQKINWRPPSYFGRDDLETLMASESAADWIRLT 271 RY+PVGLL+VIPQKINWRPPSYFGRD+LETLMASESAADWIR++ Sbjct: 610 RYVPVGLLEVIPQKINWRPPSYFGRDELETLMASESAADWIRIS 653 >ref|XP_003580470.1| PREDICTED: tRNA-dihydrouridine synthase 3-like [Brachypodium distachyon] Length = 681 Score = 89.4 bits (220), Expect = 5e-16 Identities = 37/45 (82%), Positives = 44/45 (97%) Frame = -3 Query: 405 CRYIPVGLLDVIPQKINWRPPSYFGRDDLETLMASESAADWIRLT 271 CRYIPVGLLDV+PQ++NWRPPSY GRDDLETLMAS+SAADW+R++ Sbjct: 609 CRYIPVGLLDVVPQRLNWRPPSYCGRDDLETLMASDSAADWVRIS 653