BLASTX nr result
ID: Mentha23_contig00038780
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00038780 (301 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21838.1| hypothetical protein MIMGU_mgv1a001107mg [Mimulus... 57 3e-06 gb|EYU21791.1| hypothetical protein MIMGU_mgv1a001064mg [Mimulus... 56 6e-06 >gb|EYU21838.1| hypothetical protein MIMGU_mgv1a001107mg [Mimulus guttatus] Length = 888 Score = 57.0 bits (136), Expect = 3e-06 Identities = 38/96 (39%), Positives = 51/96 (53%), Gaps = 7/96 (7%) Frame = -1 Query: 286 SEVELHDSLDSLSQARSFVCHNPGAWKLPDFRLLRTL-----HAYENGLRNFSRHCLKNV 122 SE E +L S+ RS +C G DFRLLR L H Y R + ++ ++ V Sbjct: 518 SEPEALYALQSMPLVRSLICEFKGVLPTLDFRLLRVLKAVDKHLYSEEKRQY-KYPIEVV 576 Query: 121 LQLANSRYLA--VGGHRESNVPSSIPLLWNLHTLIV 20 +L NSR++A V + PSS+ LLWNL TLIV Sbjct: 577 FRLFNSRFIAIRVDSRQNPQFPSSVNLLWNLQTLIV 612 >gb|EYU21791.1| hypothetical protein MIMGU_mgv1a001064mg [Mimulus guttatus] Length = 898 Score = 55.8 bits (133), Expect = 6e-06 Identities = 40/91 (43%), Positives = 50/91 (54%), Gaps = 9/91 (9%) Frame = -1 Query: 265 SLDSLSQARSFVCHNPGAW-KLPDFRLLRTLHAYENGLRNFSR--HC---LKNVLQLANS 104 +L S+ ARS G L RLLR L A + ++ + HC L++V QL NS Sbjct: 539 ALQSVPLARSLCFEFEGVLPSLDHCRLLRVLRAADTDFNSYGKNTHCTYTLEDVFQLVNS 598 Query: 103 RYLAVGGHRESNV---PSSIPLLWNLHTLIV 20 RYLAV R N+ PSS+ LLWNL TLIV Sbjct: 599 RYLAVDDFRYENLFRFPSSVYLLWNLQTLIV 629