BLASTX nr result
ID: Mentha23_contig00038712
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00038712 (429 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30023.1| hypothetical protein MIMGU_mgv1a025878mg, partial... 63 4e-08 gb|EPS66121.1| hypothetical protein M569_08656 [Genlisea aurea] 57 3e-06 >gb|EYU30023.1| hypothetical protein MIMGU_mgv1a025878mg, partial [Mimulus guttatus] Length = 638 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -3 Query: 118 MGSPGSNALATATRVGLSEPISTGGPSESDVTKTRELEK 2 MGSPG + ATA R+GLSEPISTGGPSE DV KTRELEK Sbjct: 1 MGSPGLSNQATAARIGLSEPISTGGPSEFDVIKTRELEK 39 >gb|EPS66121.1| hypothetical protein M569_08656 [Genlisea aurea] Length = 131 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -3 Query: 118 MGSPGSNALATATRVGLSEPISTGGPSESDVTKTRELEK 2 MGS G N AT R+G++EPISTGGP+ESD+ K +ELEK Sbjct: 1 MGSTGQNIQATPARIGITEPISTGGPTESDIVKNQELEK 39