BLASTX nr result
ID: Mentha23_contig00038679
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00038679 (318 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28364.1| hypothetical protein MIMGU_mgv1a013494mg [Mimulus... 62 8e-08 gb|EXB38893.1| hypothetical protein L484_027328 [Morus notabilis] 62 8e-08 ref|XP_002279095.1| PREDICTED: cleavage and polyadenylation spec... 62 8e-08 emb|CBI27869.3| unnamed protein product [Vitis vinifera] 62 8e-08 ref|XP_007012734.1| CFIM-25 isoform 1 [Theobroma cacao] gi|50878... 59 5e-07 ref|XP_007138689.1| hypothetical protein PHAVU_009G229700g [Phas... 59 7e-07 ref|XP_006451545.1| hypothetical protein CICLE_v10009459mg [Citr... 59 7e-07 ref|XP_004141062.1| PREDICTED: cleavage and polyadenylation spec... 58 1e-06 ref|XP_002308275.2| hypothetical protein POPTR_0006s14840g [Popu... 57 3e-06 ref|XP_006294960.1| hypothetical protein CARUB_v10024016mg [Caps... 56 4e-06 ref|XP_002867386.1| hypothetical protein ARALYDRAFT_491776 [Arab... 56 4e-06 ref|XP_004513457.1| PREDICTED: cleavage and polyadenylation spec... 56 6e-06 emb|CAB43657.1| mRNA cleavage factor subunit-like protein [Arabi... 55 1e-05 ref|NP_567835.1| CFIM-25-like protein [Arabidopsis thaliana] gi|... 55 1e-05 >gb|EYU28364.1| hypothetical protein MIMGU_mgv1a013494mg [Mimulus guttatus] Length = 219 Score = 62.0 bits (149), Expect = 8e-08 Identities = 23/35 (65%), Positives = 33/35 (94%) Frame = -1 Query: 318 AIPLCQLHENDETYGSIISGVPQLLSKYAFNYIEP 214 A+PLC+LH+N++TYG ISGVPQL+SK++FN++EP Sbjct: 180 AVPLCELHDNEQTYGQTISGVPQLMSKFSFNFVEP 214 >gb|EXB38893.1| hypothetical protein L484_027328 [Morus notabilis] Length = 221 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 318 AIPLCQLHENDETYGSIISGVPQLLSKYAFNYIE 217 A+PLCQ+HEN +TYGSIISGVPQLLSK++FN IE Sbjct: 187 AVPLCQVHENHKTYGSIISGVPQLLSKFSFNIIE 220 >ref|XP_002279095.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 5-like [Vitis vinifera] Length = 284 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 318 AIPLCQLHENDETYGSIISGVPQLLSKYAFNYIE 217 AIPLCQLHEND+TYG II+GVPQLLSK++FN I+ Sbjct: 250 AIPLCQLHENDKTYGPIIAGVPQLLSKFSFNIID 283 >emb|CBI27869.3| unnamed protein product [Vitis vinifera] Length = 291 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 318 AIPLCQLHENDETYGSIISGVPQLLSKYAFNYIE 217 AIPLCQLHEND+TYG II+GVPQLLSK++FN I+ Sbjct: 257 AIPLCQLHENDKTYGPIIAGVPQLLSKFSFNIID 290 >ref|XP_007012734.1| CFIM-25 isoform 1 [Theobroma cacao] gi|508783097|gb|EOY30353.1| CFIM-25 isoform 1 [Theobroma cacao] Length = 219 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -1 Query: 318 AIPLCQLHENDETYGSIISGVPQLLSKYAFNYIEP 214 A+PLCQ+HEN +TYG IISGVPQLLSK++ N I+P Sbjct: 185 AVPLCQVHENHKTYGPIISGVPQLLSKFSINIIDP 219 >ref|XP_007138689.1| hypothetical protein PHAVU_009G229700g [Phaseolus vulgaris] gi|561011776|gb|ESW10683.1| hypothetical protein PHAVU_009G229700g [Phaseolus vulgaris] Length = 217 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 318 AIPLCQLHENDETYGSIISGVPQLLSKYAFNYIE 217 A+PLCQ+HEN +TYG IISGVPQLLSK+ FN +E Sbjct: 183 AVPLCQVHENHKTYGEIISGVPQLLSKFCFNMME 216 >ref|XP_006451545.1| hypothetical protein CICLE_v10009459mg [Citrus clementina] gi|568843220|ref|XP_006475514.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 5-like isoform X1 [Citrus sinensis] gi|557554771|gb|ESR64785.1| hypothetical protein CICLE_v10009459mg [Citrus clementina] Length = 214 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 318 AIPLCQLHENDETYGSIISGVPQLLSKYAFNYI 220 A+PLCQ+HEN +TYG IISGVPQLLSK++FN I Sbjct: 180 AVPLCQIHENHKTYGQIISGVPQLLSKFSFNII 212 >ref|XP_004141062.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 5-like [Cucumis sativus] gi|449488056|ref|XP_004157928.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 5-like [Cucumis sativus] Length = 217 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -1 Query: 318 AIPLCQLHENDETYGSIISGVPQLLSKYAFNYI 220 A+PLCQ+HEN +TYG IISG+PQLLSK++FN I Sbjct: 183 AVPLCQIHENHKTYGPIISGIPQLLSKFSFNII 215 >ref|XP_002308275.2| hypothetical protein POPTR_0006s14840g [Populus trichocarpa] gi|550336365|gb|EEE91798.2| hypothetical protein POPTR_0006s14840g [Populus trichocarpa] Length = 258 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = -1 Query: 318 AIPLCQLHENDETYGSIISGVPQLLSKYAFN 226 A+PLCQ+HEN +TYG +ISGVPQLLSK++FN Sbjct: 225 AVPLCQVHENHKTYGPVISGVPQLLSKFSFN 255 >ref|XP_006294960.1| hypothetical protein CARUB_v10024016mg [Capsella rubella] gi|482563668|gb|EOA27858.1| hypothetical protein CARUB_v10024016mg [Capsella rubella] Length = 222 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = -1 Query: 318 AIPLCQLHENDETYGSIISGVPQLLSKYAFNYIE 217 A+PLCQLHEN++TYG IIS +P+LLSK++FN +E Sbjct: 188 AVPLCQLHENEKTYGPIISQIPKLLSKFSFNMME 221 >ref|XP_002867386.1| hypothetical protein ARALYDRAFT_491776 [Arabidopsis lyrata subsp. lyrata] gi|297313222|gb|EFH43645.1| hypothetical protein ARALYDRAFT_491776 [Arabidopsis lyrata subsp. lyrata] Length = 223 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = -1 Query: 318 AIPLCQLHENDETYGSIISGVPQLLSKYAFNYIE 217 A+PLCQLHEN++TYG IIS +P+LLSK++FN +E Sbjct: 189 AVPLCQLHENEKTYGPIISQIPKLLSKFSFNMME 222 >ref|XP_004513457.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 5-like isoform X3 [Cicer arietinum] Length = 202 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -1 Query: 318 AIPLCQLHENDETYGSIISGVPQLLSKYAFNYIE 217 ++PLCQ+HEN +TYG IIS +PQLLSK++FN IE Sbjct: 168 SVPLCQIHENHKTYGPIISRIPQLLSKFSFNMIE 201 >emb|CAB43657.1| mRNA cleavage factor subunit-like protein [Arabidopsis thaliana] gi|7269881|emb|CAB79740.1| mRNA cleavage factor subunit-like protein [Arabidopsis thaliana] Length = 185 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/34 (64%), Positives = 31/34 (91%) Frame = -1 Query: 318 AIPLCQLHENDETYGSIISGVPQLLSKYAFNYIE 217 A+PLCQLHEN++TYG I+S +P+LLSK++FN +E Sbjct: 151 AVPLCQLHENEKTYGPIMSQIPKLLSKFSFNMME 184 >ref|NP_567835.1| CFIM-25-like protein [Arabidopsis thaliana] gi|15081674|gb|AAK82492.1| AT4g29820/F27B13_60 [Arabidopsis thaliana] gi|20147173|gb|AAM10303.1| AT4g29820/F27B13_60 [Arabidopsis thaliana] gi|21554114|gb|AAM63194.1| mRNA cleavage factor subunit-like protein [Arabidopsis thaliana] gi|332660282|gb|AEE85682.1| CFIM-25-like protein [Arabidopsis thaliana] Length = 222 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/34 (64%), Positives = 31/34 (91%) Frame = -1 Query: 318 AIPLCQLHENDETYGSIISGVPQLLSKYAFNYIE 217 A+PLCQLHEN++TYG I+S +P+LLSK++FN +E Sbjct: 188 AVPLCQLHENEKTYGPIMSQIPKLLSKFSFNMME 221