BLASTX nr result
ID: Mentha23_contig00038453
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00038453 (451 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42722.1| hypothetical protein MIMGU_mgv1a026859mg, partial... 55 1e-05 >gb|EYU42722.1| hypothetical protein MIMGU_mgv1a026859mg, partial [Mimulus guttatus] Length = 159 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = -1 Query: 109 MENGEGILESRFAELTMNDPYSINGNDGLLQVMKAV 2 MENG+ LES+FA L+++DPY++NG+DGL QVMKAV Sbjct: 1 MENGDANLESKFAGLSVSDPYNVNGSDGLFQVMKAV 36