BLASTX nr result
ID: Mentha23_contig00038181
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00038181 (757 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39707.1| hypothetical protein MIMGU_mgv1a015231mg [Mimulus... 73 1e-10 >gb|EYU39707.1| hypothetical protein MIMGU_mgv1a015231mg [Mimulus guttatus] Length = 164 Score = 72.8 bits (177), Expect = 1e-10 Identities = 36/54 (66%), Positives = 42/54 (77%), Gaps = 3/54 (5%) Frame = -2 Query: 756 IGLDGCASSILSKGWNNLTKTDMTNLPSFPSTPLQLAM---ADSPTVRSLLETK 604 IGLDGCASSILSKGWNN + + NLPS P TP++LAM AD P+ RSLL+TK Sbjct: 111 IGLDGCASSILSKGWNNFDEPETKNLPSVPLTPVELAMTTYADKPSFRSLLQTK 164