BLASTX nr result
ID: Mentha23_contig00038165
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00038165 (510 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28820.1| hypothetical protein MIMGU_mgv1a008353mg [Mimulus... 72 6e-11 >gb|EYU28820.1| hypothetical protein MIMGU_mgv1a008353mg [Mimulus guttatus] Length = 376 Score = 72.4 bits (176), Expect = 6e-11 Identities = 42/75 (56%), Positives = 50/75 (66%), Gaps = 1/75 (1%) Frame = +3 Query: 288 MGRWGWRVSVTVSRIVSASKSINKQELSRNPRIRSQNPPLISGIMSSFLGFRRFSALPE- 464 MGRW R S+ V+RIVSASKSIN ++ NP +RS LIS + FL FR FSALP Sbjct: 1 MGRW--RASLIVARIVSASKSINNLNINHNPPLRSPYSLLISERRNYFLNFRSFSALPSV 58 Query: 465 SPRYVEEFDVNSHDF 509 PR EEFD ++HDF Sbjct: 59 FPRDAEEFDYSTHDF 73