BLASTX nr result
ID: Mentha23_contig00038043
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00038043 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21269.1| hypothetical protein MIMGU_mgv1a002768mg [Mimulus... 72 6e-11 >gb|EYU21269.1| hypothetical protein MIMGU_mgv1a002768mg [Mimulus guttatus] Length = 639 Score = 72.4 bits (176), Expect = 6e-11 Identities = 44/87 (50%), Positives = 57/87 (65%), Gaps = 7/87 (8%) Frame = -1 Query: 354 RLSSGFISKSGTPFLAHQGSTKSKKLGDQK-SKARGFPKEDDTFSKSKKRKISKDGSSVK 178 RL+S F S S +PFLAHQG K KK G++ + RGF K+D+ SKSK+ K K G+S + Sbjct: 542 RLNSAFPSSSVSPFLAHQG--KPKKSGNKHVPEGRGFAKDDENLSKSKRHKTGKTGNSTE 599 Query: 177 TEN------EKTSTAKNEKKRRKKDGI 115 N EK+ST K EKKRR+KDG+ Sbjct: 600 NNNGGEIHDEKSSTVK-EKKRRRKDGL 625