BLASTX nr result
ID: Mentha23_contig00037700
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00037700 (392 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23553.1| hypothetical protein MIMGU_mgv1a010717mg [Mimulus... 59 7e-07 >gb|EYU23553.1| hypothetical protein MIMGU_mgv1a010717mg [Mimulus guttatus] Length = 304 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/44 (68%), Positives = 35/44 (79%), Gaps = 4/44 (9%) Frame = +3 Query: 273 MSNPNITLSIASPQ-NITDPPVRAKI---SEWYNSQTEGCNSFW 392 MSNPNITLSIAS NIT+PPVR++I SEWY+ + GCNSFW Sbjct: 1 MSNPNITLSIASVAINITEPPVRSRIGRVSEWYSYGSAGCNSFW 44