BLASTX nr result
ID: Mentha23_contig00037449
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00037449 (711 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274971.1| PREDICTED: uncharacterized protein LOC100252... 58 3e-06 emb|CAN76581.1| hypothetical protein VITISV_034321 [Vitis vinifera] 58 3e-06 >ref|XP_002274971.1| PREDICTED: uncharacterized protein LOC100252988 [Vitis vinifera] Length = 973 Score = 58.2 bits (139), Expect = 3e-06 Identities = 25/51 (49%), Positives = 35/51 (68%) Frame = +3 Query: 486 VQDQGHDMPLPQIGGEIPYVNSSSYDELCVLPESGDDLFDVLGADFKNKLF 638 V D H+ P P+ G + P ++ +++ CV P SGDDLFD+LG DFK+KLF Sbjct: 524 VPDFLHEFPKPENGSQTPRSKNAIHEDTCVRPASGDDLFDILGVDFKSKLF 574 >emb|CAN76581.1| hypothetical protein VITISV_034321 [Vitis vinifera] Length = 1023 Score = 58.2 bits (139), Expect = 3e-06 Identities = 25/51 (49%), Positives = 35/51 (68%) Frame = +3 Query: 486 VQDQGHDMPLPQIGGEIPYVNSSSYDELCVLPESGDDLFDVLGADFKNKLF 638 V D H+ P P+ G + P ++ +++ CV P SGDDLFD+LG DFK+KLF Sbjct: 524 VPDFLHEFPKPENGSQTPRSKNAIHEDTCVRPASGDDLFDILGVDFKSKLF 574