BLASTX nr result
ID: Mentha23_contig00037251
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00037251 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36362.1| hypothetical protein MIMGU_mgv1a009109mg [Mimulus... 59 5e-07 >gb|EYU36362.1| hypothetical protein MIMGU_mgv1a009109mg [Mimulus guttatus] Length = 353 Score = 59.3 bits (142), Expect = 5e-07 Identities = 33/66 (50%), Positives = 40/66 (60%), Gaps = 2/66 (3%) Frame = -2 Query: 381 AMEHYMQVLSQYIPDWMHTSSADDKIQ--RKMEPEDYISAAELERNSEASTSPVSDFSTN 208 AME Y+ VLS IP WMH S D+ IQ K+E D IS E ERN + S + + D ST Sbjct: 286 AMEKYVTVLSDTIPHWMHHYSPDEDIQGHHKLETVDKISVPEYERNLDMSAAAIGDSSTG 345 Query: 207 ESSVDK 190 SSV+K Sbjct: 346 GSSVEK 351