BLASTX nr result
ID: Mentha23_contig00037068
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00037068 (346 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46063.1| hypothetical protein MIMGU_mgv1a011914mg [Mimulus... 56 4e-06 gb|EYU46062.1| hypothetical protein MIMGU_mgv1a011914mg [Mimulus... 56 4e-06 >gb|EYU46063.1| hypothetical protein MIMGU_mgv1a011914mg [Mimulus guttatus] Length = 222 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/51 (54%), Positives = 35/51 (68%) Frame = +1 Query: 193 ATKMAHSILRSYLRFPSVGICSFAKPASTFSRCHGYTNHYGYGSFCFAQKA 345 A +MA+SI+RS+LRFPS ICSF KPAS SR + N+ Y SF +KA Sbjct: 4 ANQMANSIVRSFLRFPSYSICSFTKPASACSRWYRNNNYRTYTSFRLVEKA 54 >gb|EYU46062.1| hypothetical protein MIMGU_mgv1a011914mg [Mimulus guttatus] Length = 267 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/51 (54%), Positives = 35/51 (68%) Frame = +1 Query: 193 ATKMAHSILRSYLRFPSVGICSFAKPASTFSRCHGYTNHYGYGSFCFAQKA 345 A +MA+SI+RS+LRFPS ICSF KPAS SR + N+ Y SF +KA Sbjct: 4 ANQMANSIVRSFLRFPSYSICSFTKPASACSRWYRNNNYRTYTSFRLVEKA 54