BLASTX nr result
ID: Mentha23_contig00036276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00036276 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30018.1| hypothetical protein MIMGU_mgv1a019270mg, partial... 57 2e-06 >gb|EYU30018.1| hypothetical protein MIMGU_mgv1a019270mg, partial [Mimulus guttatus] Length = 128 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = +1 Query: 214 SPYHLLPDSGD-SRLNQLGYKQELRRTLSAIANFS 315 +PYHLL DSGD SRLNQLGYKQEL R+LSA++NFS Sbjct: 14 APYHLLKDSGDDSRLNQLGYKQELSRSLSAVSNFS 48