BLASTX nr result
ID: Mentha23_contig00036236
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00036236 (330 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29658.1| hypothetical protein MIMGU_mgv1a006859mg [Mimulus... 68 1e-09 >gb|EYU29658.1| hypothetical protein MIMGU_mgv1a006859mg [Mimulus guttatus] Length = 428 Score = 68.2 bits (165), Expect = 1e-09 Identities = 40/105 (38%), Positives = 54/105 (51%) Frame = +3 Query: 3 VRRRHNQHSEVLLPREDEYKSWKQDNIVFGSEEPSHNFKRMSKNDEADDRPAFGHVTKVN 182 VRRRH +E L RE+ YKSW+QDN +F SE PS+++ + SKND DR AFG V + Sbjct: 173 VRRRHQ--TEALHSREEVYKSWQQDNTIFHSERPSYHYPKKSKNDRLGDRHAFGRVAE-- 228 Query: 183 KRERGRKNSEISREEDISDHFDGCHETPKLNSHEQTHSSHKESVD 317 FDGC + + + Q H ++ SVD Sbjct: 229 --------------------FDGCLKFIEADKCVQMHRKYQYSVD 253