BLASTX nr result
ID: Mentha23_contig00036213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00036213 (593 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP87140.1| somatic embryogenesis receptor-like kinase [Camel... 61 2e-07 gb|AFS64762.1| protein kinase, partial [Prunus salicina] 61 3e-07 gb|AFX61784.1| somatic embryogenesis receptor-like kinase [Camel... 60 5e-07 ref|XP_006351807.1| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass... 60 6e-07 ref|NP_001233871.1| somatic embryogenesis receptor kinase 3B pre... 60 6e-07 ref|XP_002455108.1| hypothetical protein SORBIDRAFT_03g004450 [S... 59 1e-06 ref|XP_006341833.1| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass... 59 1e-06 ref|NP_001274956.1| BRASSINOSTEROID INSENSITIVE 1-associated rec... 59 1e-06 gb|AGT21432.1| somatic embryogenesis receptor kinase 3A [Solanum... 59 1e-06 gb|AEC46977.1| somatic embryogenesis receptor-like kinase [Anana... 59 1e-06 ref|NP_001234626.1| somatic embryogenesis receptor kinase 3A pre... 59 1e-06 gb|ADO86983.1| SERK3B [Nicotiana benthamiana] 59 1e-06 gb|ADO86982.1| SERK3A [Nicotiana benthamiana] 59 1e-06 ref|XP_006844161.1| hypothetical protein AMTR_s00006p00261510 [A... 58 2e-06 ref|XP_004968347.1| PREDICTED: protein NSP-INTERACTING KINASE 3-... 58 2e-06 ref|XP_004963510.1| PREDICTED: protein NSP-INTERACTING KINASE 3-... 58 2e-06 gb|EMS65008.1| Somatic embryogenesis receptor kinase 2 [Triticum... 58 2e-06 gb|AET86626.2| somatic embryogenesis receptor kinase 1, partial ... 58 2e-06 gb|AFW80157.1| putative leucine-rich repeat receptor-like protei... 58 2e-06 ref|XP_003571417.1| PREDICTED: somatic embryogenesis receptor ki... 58 2e-06 >gb|AFP87140.1| somatic embryogenesis receptor-like kinase [Camellia nitidissima] Length = 624 Score = 61.2 bits (147), Expect = 2e-07 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 3/65 (4%) Frame = -2 Query: 235 YNSVLIKKLVQISVLCTQYDPDKRPRMSDVVRMLEVGDVLAERSEERSKKEVGE---EGG 65 Y +++L+Q+++LCTQ P RP+MS+VVRMLE GD LAER EE K EV E G Sbjct: 542 YVDAEVEQLIQVALLCTQGSPMDRPKMSEVVRMLE-GDGLAERWEEWQKVEVDRHEIEMG 600 Query: 64 PPKNY 50 PP+N+ Sbjct: 601 PPRNF 605 >gb|AFS64762.1| protein kinase, partial [Prunus salicina] Length = 275 Score = 60.8 bits (146), Expect = 3e-07 Identities = 33/73 (45%), Positives = 49/73 (67%) Frame = -2 Query: 235 YNSVLIKKLVQISVLCTQYDPDKRPRMSDVVRMLEVGDVLAERSEERSKKEVGEEGGPPK 56 YN +++L+Q+++LCTQ P +RP+MS+VVRMLE GD LAER EE K+E+ + P Sbjct: 191 YNDDEVEQLIQVALLCTQGTPGERPKMSEVVRMLE-GDGLAERWEEWQKEEMFRQDFNPI 249 Query: 55 NYIDAEPIEDDDS 17 + ++ I D S Sbjct: 250 QHANSNWIMDSSS 262 >gb|AFX61784.1| somatic embryogenesis receptor-like kinase [Camellia nitidissima] Length = 624 Score = 60.1 bits (144), Expect = 5e-07 Identities = 34/64 (53%), Positives = 44/64 (68%), Gaps = 3/64 (4%) Frame = -2 Query: 235 YNSVLIKKLVQISVLCTQYDPDKRPRMSDVVRMLEVGDVLAERSEERSKKEVGE---EGG 65 Y +++L+Q+++LCTQ P RP+MS+VVRMLE GD LAER EE K EV E G Sbjct: 542 YVDAEVEQLIQVALLCTQGSPMDRPKMSEVVRMLE-GDGLAERWEEWQKVEVDRHEIEMG 600 Query: 64 PPKN 53 PP+N Sbjct: 601 PPRN 604 >ref|XP_006351807.1| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1-like [Solanum tuberosum] Length = 617 Score = 59.7 bits (143), Expect = 6e-07 Identities = 30/52 (57%), Positives = 41/52 (78%) Frame = -2 Query: 235 YNSVLIKKLVQISVLCTQYDPDKRPRMSDVVRMLEVGDVLAERSEERSKKEV 80 YN +K+L+Q+++LCTQ P +RP+MS+VVRMLE GD LAER EE K+E+ Sbjct: 534 YNEEEVKQLIQVALLCTQSSPMERPKMSEVVRMLE-GDGLAERWEEWQKEEM 584 >ref|NP_001233871.1| somatic embryogenesis receptor kinase 3B precursor [Solanum lycopersicum] gi|321146044|gb|ADW65660.1| somatic embryogenesis receptor kinase 3B [Solanum lycopersicum] gi|453700232|gb|AGG23557.1| somatic embryogenesis receptor kinase 3B [Solanum lycopersicum] Length = 617 Score = 59.7 bits (143), Expect = 6e-07 Identities = 30/52 (57%), Positives = 41/52 (78%) Frame = -2 Query: 235 YNSVLIKKLVQISVLCTQYDPDKRPRMSDVVRMLEVGDVLAERSEERSKKEV 80 YN +K+L+Q+++LCTQ P +RP+MS+VVRMLE GD LAER EE K+E+ Sbjct: 534 YNEEEVKQLIQVALLCTQSSPMERPKMSEVVRMLE-GDGLAERWEEWQKEEM 584 >ref|XP_002455108.1| hypothetical protein SORBIDRAFT_03g004450 [Sorghum bicolor] gi|241927083|gb|EES00228.1| hypothetical protein SORBIDRAFT_03g004450 [Sorghum bicolor] Length = 615 Score = 58.9 bits (141), Expect = 1e-06 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 4/68 (5%) Frame = -2 Query: 235 YNSVLIKKLVQISVLCTQYDPDKRPRMSDVVRMLEVGDVLAERSEER----SKKEVGEEG 68 Y+ V ++++VQ+++LCTQY P RPRMS+V+RMLE GD LAE+ E + K V E Sbjct: 531 YDRVELEEMVQVALLCTQYHPSHRPRMSEVIRMLE-GDGLAEKWEASQNVDTPKSVSSEI 589 Query: 67 GPPKNYID 44 PPK Y+D Sbjct: 590 LPPK-YMD 596 >ref|XP_006341833.1| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1-like isoform X1 [Solanum tuberosum] Length = 622 Score = 58.5 bits (140), Expect = 1e-06 Identities = 29/52 (55%), Positives = 41/52 (78%) Frame = -2 Query: 235 YNSVLIKKLVQISVLCTQYDPDKRPRMSDVVRMLEVGDVLAERSEERSKKEV 80 YN +++L+Q+++LCTQ P +RP+MS+VVRMLE GD LAER EE K+E+ Sbjct: 532 YNEEEVEQLIQVALLCTQSTPTERPKMSEVVRMLE-GDGLAERWEEWQKEEM 582 >ref|NP_001274956.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1-like precursor [Solanum tuberosum] gi|530341407|gb|AGT21433.1| somatic embryogenesis receptor kinase 3B [Solanum tuberosum] Length = 615 Score = 58.5 bits (140), Expect = 1e-06 Identities = 29/52 (55%), Positives = 41/52 (78%) Frame = -2 Query: 235 YNSVLIKKLVQISVLCTQYDPDKRPRMSDVVRMLEVGDVLAERSEERSKKEV 80 YN +++L+Q+++LCTQ P +RP+MS+VVRMLE GD LAER EE K+E+ Sbjct: 532 YNEEEVEQLIQVALLCTQSTPTERPKMSEVVRMLE-GDGLAERWEEWQKEEM 582 >gb|AGT21432.1| somatic embryogenesis receptor kinase 3A [Solanum tuberosum] Length = 615 Score = 58.5 bits (140), Expect = 1e-06 Identities = 29/52 (55%), Positives = 41/52 (78%) Frame = -2 Query: 235 YNSVLIKKLVQISVLCTQYDPDKRPRMSDVVRMLEVGDVLAERSEERSKKEV 80 YN +++L+Q+++LCTQ P +RP+MS+VVRMLE GD LAER EE K+E+ Sbjct: 532 YNEEEVEQLIQVALLCTQSTPTERPKMSEVVRMLE-GDGLAERWEEWQKEEM 582 >gb|AEC46977.1| somatic embryogenesis receptor-like kinase [Ananas comosus] gi|374433972|gb|AEZ52378.1| somatic embryogenesis receptor-like kinase 3 [Ananas comosus] Length = 629 Score = 58.5 bits (140), Expect = 1e-06 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 2/76 (2%) Frame = -2 Query: 235 YNSVLIKKLVQISVLCTQYDPDKRPRMSDVVRMLEVGDVLAERSEERSKKEV--GEEGGP 62 Y V ++ L+Q+++LCTQ P +RP+MS+VVRMLE GD LAER EE K EV E Sbjct: 546 YIDVEVESLIQVALLCTQSSPMERPKMSEVVRMLE-GDGLAERWEEWQKVEVVRQEMEMD 604 Query: 61 PKNYIDAEPIEDDDSL 14 P+N+ I+ D+L Sbjct: 605 PRNHNSEWIIDSTDNL 620 >ref|NP_001234626.1| somatic embryogenesis receptor kinase 3A precursor [Solanum lycopersicum] gi|321146042|gb|ADW65659.1| somatic embryogenesis receptor kinase 3A [Solanum lycopersicum] gi|453700218|gb|AGG23556.1| somatic embryogenesis receptor kinase 3A [Solanum lycopersicum] Length = 615 Score = 58.5 bits (140), Expect = 1e-06 Identities = 29/52 (55%), Positives = 41/52 (78%) Frame = -2 Query: 235 YNSVLIKKLVQISVLCTQYDPDKRPRMSDVVRMLEVGDVLAERSEERSKKEV 80 YN +++L+Q+++LCTQ P +RP+MS+VVRMLE GD LAER EE K+E+ Sbjct: 532 YNEEEVEQLIQVALLCTQSTPTERPKMSEVVRMLE-GDGLAERWEEWQKEEM 582 >gb|ADO86983.1| SERK3B [Nicotiana benthamiana] Length = 615 Score = 58.5 bits (140), Expect = 1e-06 Identities = 29/52 (55%), Positives = 41/52 (78%) Frame = -2 Query: 235 YNSVLIKKLVQISVLCTQYDPDKRPRMSDVVRMLEVGDVLAERSEERSKKEV 80 YN +++L+Q+++LCTQ P +RP+MS+VVRMLE GD LAER EE K+E+ Sbjct: 532 YNEEEVEQLIQVALLCTQSTPTERPKMSEVVRMLE-GDGLAERWEEWQKEEM 582 >gb|ADO86982.1| SERK3A [Nicotiana benthamiana] Length = 615 Score = 58.5 bits (140), Expect = 1e-06 Identities = 29/52 (55%), Positives = 41/52 (78%) Frame = -2 Query: 235 YNSVLIKKLVQISVLCTQYDPDKRPRMSDVVRMLEVGDVLAERSEERSKKEV 80 YN +++L+Q+++LCTQ P +RP+MS+VVRMLE GD LAER EE K+E+ Sbjct: 532 YNEEEVEQLIQVALLCTQSTPTERPKMSEVVRMLE-GDGLAERWEEWQKEEM 582 >ref|XP_006844161.1| hypothetical protein AMTR_s00006p00261510 [Amborella trichopoda] gi|548846560|gb|ERN05836.1| hypothetical protein AMTR_s00006p00261510 [Amborella trichopoda] Length = 620 Score = 58.2 bits (139), Expect = 2e-06 Identities = 31/74 (41%), Positives = 47/74 (63%) Frame = -2 Query: 235 YNSVLIKKLVQISVLCTQYDPDKRPRMSDVVRMLEVGDVLAERSEERSKKEVGEEGGPPK 56 Y+ + ++++VQ+++LCTQY P RP+MS+VVRMLE GD LAER E + + + G Sbjct: 537 YDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLE-GDGLAERWEASQRSDTSKFRGSDL 595 Query: 55 NYIDAEPIEDDDSL 14 + + DD SL Sbjct: 596 SSERYSDLTDDSSL 609 >ref|XP_004968347.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Setaria italica] Length = 633 Score = 58.2 bits (139), Expect = 2e-06 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 4/68 (5%) Frame = -2 Query: 235 YNSVLIKKLVQISVLCTQYDPDKRPRMSDVVRMLEVGDVLAERSEER----SKKEVGEEG 68 Y+ V ++++VQ+++LCTQY P RPRMS+V+RMLE GD LAE+ E + K V E Sbjct: 549 YDRVELEEMVQVALLCTQYYPSHRPRMSEVIRMLE-GDGLAEKWEASQNVDTPKSVSSEL 607 Query: 67 GPPKNYID 44 PPK Y+D Sbjct: 608 LPPK-YMD 614 >ref|XP_004963510.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Setaria italica] Length = 555 Score = 58.2 bits (139), Expect = 2e-06 Identities = 33/73 (45%), Positives = 48/73 (65%) Frame = -2 Query: 235 YNSVLIKKLVQISVLCTQYDPDKRPRMSDVVRMLEVGDVLAERSEERSKKEVGEEGGPPK 56 Y++V + K++QI++LCT Y P RPRMS+VV MLE GD +AE+ E + K V EE P + Sbjct: 472 YDTVELVKMIQIALLCTMYSPKHRPRMSEVVTMLEEGDGVAEKWE--AMKNV-EEADPDE 528 Query: 55 NYIDAEPIEDDDS 17 + A ++D S Sbjct: 529 SAYRAINYDEDQS 541 >gb|EMS65008.1| Somatic embryogenesis receptor kinase 2 [Triticum urartu] Length = 540 Score = 58.2 bits (139), Expect = 2e-06 Identities = 33/64 (51%), Positives = 44/64 (68%), Gaps = 3/64 (4%) Frame = -2 Query: 235 YNSVLIKKLVQISVLCTQYDPDKRPRMSDVVRMLEVGDVLAERSEERSKKEVGE---EGG 65 Y V ++ L+Q+++LCTQ P +RP+MS+VVRMLE GD LAER +E K EV E G Sbjct: 458 YIDVEVESLIQVALLCTQGSPTERPKMSEVVRMLE-GDGLAERWDEWQKVEVSRQEVELG 516 Query: 64 PPKN 53 P +N Sbjct: 517 PHRN 520 >gb|AET86626.2| somatic embryogenesis receptor kinase 1, partial [Dactylis glomerata] Length = 317 Score = 58.2 bits (139), Expect = 2e-06 Identities = 34/64 (53%), Positives = 44/64 (68%), Gaps = 3/64 (4%) Frame = -2 Query: 235 YNSVLIKKLVQISVLCTQYDPDKRPRMSDVVRMLEVGDVLAERSEERSKKEVGE---EGG 65 Y V ++ L+Q+++LCTQ P +RP+MS+VVRMLE GD LAER EE K EV E G Sbjct: 235 YIDVEVESLIQVALLCTQGSPTERPKMSEVVRMLE-GDGLAERWEEWQKIEVVRQEVEMG 293 Query: 64 PPKN 53 P +N Sbjct: 294 PHRN 297 >gb|AFW80157.1| putative leucine-rich repeat receptor-like protein kinase family protein [Zea mays] Length = 630 Score = 58.2 bits (139), Expect = 2e-06 Identities = 33/69 (47%), Positives = 45/69 (65%), Gaps = 5/69 (7%) Frame = -2 Query: 235 YNSVLIKKLVQISVLCTQYDPDKRPRMSDVVRMLEVGDVLAER-----SEERSKKEVGEE 71 Y+ V ++++VQ+++LCTQY P RPRMS+V+RMLE LAER S + K V E Sbjct: 543 YDGVELEEMVQLALLCTQYHPSHRPRMSEVIRMLEGEPGLAERWEASQSNVDTPKSVSSE 602 Query: 70 GGPPKNYID 44 PPK Y+D Sbjct: 603 LLPPK-YVD 610 >ref|XP_003571417.1| PREDICTED: somatic embryogenesis receptor kinase 1-like, partial [Brachypodium distachyon] Length = 615 Score = 58.2 bits (139), Expect = 2e-06 Identities = 34/64 (53%), Positives = 44/64 (68%), Gaps = 3/64 (4%) Frame = -2 Query: 235 YNSVLIKKLVQISVLCTQYDPDKRPRMSDVVRMLEVGDVLAERSEERSKKEVGE---EGG 65 Y V ++ L+Q+++LCTQ P +RP+MS+VVRMLE GD LAER EE K EV E G Sbjct: 533 YIDVEVESLIQVALLCTQGSPTERPKMSEVVRMLE-GDGLAERWEEWQKVEVVRQEVELG 591 Query: 64 PPKN 53 P +N Sbjct: 592 PHRN 595