BLASTX nr result
ID: Mentha23_contig00035977
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00035977 (311 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21909.1| hypothetical protein MIMGU_mgv1a010905mg [Mimulus... 65 7e-09 >gb|EYU21909.1| hypothetical protein MIMGU_mgv1a010905mg [Mimulus guttatus] Length = 298 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/67 (47%), Positives = 45/67 (67%) Frame = -3 Query: 270 MAAPLPTLQSHHSLSPNLPIFGNNAQSMSVSSKRKLEARRKSHKIVGCLSNSSRPSSENG 91 MAA LP+++SHHSL PN+ I+ NN Q +S+ ++ K RK + L +SS P +NG Sbjct: 1 MAAALPSIKSHHSLLPNISIYRNNGQRISILTQTKPRTCRKLRRTSASLGDSSTPFWQNG 60 Query: 90 ILRRDLM 70 I+RRDLM Sbjct: 61 IVRRDLM 67