BLASTX nr result
ID: Mentha23_contig00035784
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00035784 (338 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25776.1| hypothetical protein MIMGU_mgv1a016920mg [Mimulus... 62 1e-07 >gb|EYU25776.1| hypothetical protein MIMGU_mgv1a016920mg [Mimulus guttatus] Length = 101 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +3 Query: 3 SRPLSKRKCWTVAEILKRARVYVPPSLNKDVPTPND 110 SRPLSKRK W VAEILK+AR+YVPPSL+KD TP D Sbjct: 60 SRPLSKRKNWIVAEILKKARIYVPPSLSKDASTPGD 95