BLASTX nr result
ID: Mentha23_contig00035642
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00035642 (359 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007136494.1| hypothetical protein PHAVU_009G050000g [Phas... 56 6e-06 >ref|XP_007136494.1| hypothetical protein PHAVU_009G050000g [Phaseolus vulgaris] gi|561009581|gb|ESW08488.1| hypothetical protein PHAVU_009G050000g [Phaseolus vulgaris] Length = 33 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 118 MSNIPRSLTDSALNLFKLAISASDPWPFSI 207 MSNIPRSLTDS+L LF LAIS+SDPWPFS+ Sbjct: 1 MSNIPRSLTDSSLTLFNLAISSSDPWPFSL 30