BLASTX nr result
ID: Mentha23_contig00035074
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00035074 (651 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43653.1| hypothetical protein MIMGU_mgv1a000759mg [Mimulus... 61 3e-07 >gb|EYU43653.1| hypothetical protein MIMGU_mgv1a000759mg [Mimulus guttatus] Length = 992 Score = 60.8 bits (146), Expect = 3e-07 Identities = 33/47 (70%), Positives = 38/47 (80%), Gaps = 4/47 (8%) Frame = +1 Query: 523 LQLTAVAGK----SSDDAGEEERLLGAHDDEDSESLRRIQVGVTGMT 651 LQLTAVAGK S++DAGEE+RLLGA+D+E S LRRI V VTGMT Sbjct: 4 LQLTAVAGKGSGASAEDAGEEDRLLGAYDEEYSADLRRINVSVTGMT 50