BLASTX nr result
ID: Mentha23_contig00034757
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00034757 (498 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45293.1| hypothetical protein MIMGU_mgv1a013178mg [Mimulus... 73 4e-11 gb|EPS69485.1| hypothetical protein M569_05283 [Genlisea aurea] 72 1e-10 ref|XP_002321975.1| rhodanese-like domain-containing family prot... 72 1e-10 ref|XP_006491648.1| PREDICTED: rhodanese-like domain-containing ... 71 1e-10 ref|XP_006491647.1| PREDICTED: rhodanese-like domain-containing ... 71 1e-10 ref|XP_006441184.1| hypothetical protein CICLE_v10021946mg [Citr... 71 1e-10 ref|XP_006441183.1| hypothetical protein CICLE_v10021946mg [Citr... 71 1e-10 ref|XP_004307943.1| PREDICTED: rhodanese-like domain-containing ... 71 1e-10 ref|XP_006413041.1| hypothetical protein EUTSA_v10026171mg [Eutr... 71 2e-10 ref|XP_002317802.2| rhodanese-like domain-containing family prot... 71 2e-10 gb|AFP55543.1| rhodanese-like domain-containing protein [Rosa ru... 71 2e-10 gb|ABK96337.1| unknown [Populus trichocarpa x Populus deltoides] 71 2e-10 ref|XP_007039149.1| Rhodanese/Cell cycle control phosphatase sup... 70 3e-10 ref|XP_007039148.1| Rhodanese/Cell cycle control phosphatase sup... 70 3e-10 gb|EMT05045.1| hypothetical protein F775_26396 [Aegilops tauschii] 70 3e-10 ref|XP_004502705.1| PREDICTED: rhodanese-like domain-containing ... 70 4e-10 ref|XP_002274646.1| PREDICTED: uncharacterized protein LOC100245... 70 4e-10 gb|EMS60178.1| hypothetical protein TRIUR3_11770 [Triticum urartu] 69 9e-10 ref|NP_001149014.1| rhodanese-like domain containing protein [Ze... 69 9e-10 gb|EXC21396.1| hypothetical protein L484_011837 [Morus notabilis] 68 1e-09 >gb|EYU45293.1| hypothetical protein MIMGU_mgv1a013178mg [Mimulus guttatus] Length = 228 Score = 73.2 bits (178), Expect = 4e-11 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +2 Query: 368 RSFIAAYVLVLNGYKNVYHLEGGIYKWFKEGLPSESEE 481 RSFIAAY+LVLNGY NV+HLEGG+YKWFKE LP+ESEE Sbjct: 191 RSFIAAYLLVLNGYTNVFHLEGGLYKWFKEDLPTESEE 228 >gb|EPS69485.1| hypothetical protein M569_05283 [Genlisea aurea] Length = 221 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 368 RSFIAAYVLVLNGYKNVYHLEGGIYKWFKEGLPSESEE 481 RS IAAY+LVLNGY NVYHLEGG Y WFKEGLPSES+E Sbjct: 184 RSLIAAYLLVLNGYTNVYHLEGGTYAWFKEGLPSESQE 221 >ref|XP_002321975.1| rhodanese-like domain-containing family protein [Populus trichocarpa] gi|222868971|gb|EEF06102.1| rhodanese-like domain-containing family protein [Populus trichocarpa] Length = 239 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +2 Query: 368 RSFIAAYVLVLNGYKNVYHLEGGIYKWFKEGLPSESE 478 RS IAAY+LVLNGY NV+HLEGG+YKWFKEGLP+ESE Sbjct: 202 RSLIAAYLLVLNGYTNVFHLEGGLYKWFKEGLPAESE 238 >ref|XP_006491648.1| PREDICTED: rhodanese-like domain-containing protein 14, chloroplastic-like isoform X2 [Citrus sinensis] gi|568877907|ref|XP_006491959.1| PREDICTED: rhodanese-like domain-containing protein 14, chloroplastic-like [Citrus sinensis] Length = 240 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 368 RSFIAAYVLVLNGYKNVYHLEGGIYKWFKEGLPSESEE 481 RS IAAY+LVLNGYKNVYHLEGG+YKWFKE LP SEE Sbjct: 203 RSLIAAYLLVLNGYKNVYHLEGGLYKWFKEELPEVSEE 240 >ref|XP_006491647.1| PREDICTED: rhodanese-like domain-containing protein 14, chloroplastic-like isoform X1 [Citrus sinensis] Length = 241 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 368 RSFIAAYVLVLNGYKNVYHLEGGIYKWFKEGLPSESEE 481 RS IAAY+LVLNGYKNVYHLEGG+YKWFKE LP SEE Sbjct: 204 RSLIAAYLLVLNGYKNVYHLEGGLYKWFKEELPEVSEE 241 >ref|XP_006441184.1| hypothetical protein CICLE_v10021946mg [Citrus clementina] gi|557543446|gb|ESR54424.1| hypothetical protein CICLE_v10021946mg [Citrus clementina] Length = 241 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 368 RSFIAAYVLVLNGYKNVYHLEGGIYKWFKEGLPSESEE 481 RS IAAY+LVLNGYKNVYHLEGG+YKWFKE LP SEE Sbjct: 204 RSLIAAYLLVLNGYKNVYHLEGGLYKWFKEELPEVSEE 241 >ref|XP_006441183.1| hypothetical protein CICLE_v10021946mg [Citrus clementina] gi|557543445|gb|ESR54423.1| hypothetical protein CICLE_v10021946mg [Citrus clementina] Length = 240 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 368 RSFIAAYVLVLNGYKNVYHLEGGIYKWFKEGLPSESEE 481 RS IAAY+LVLNGYKNVYHLEGG+YKWFKE LP SEE Sbjct: 203 RSLIAAYLLVLNGYKNVYHLEGGLYKWFKEELPEVSEE 240 >ref|XP_004307943.1| PREDICTED: rhodanese-like domain-containing protein 14, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 231 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +2 Query: 368 RSFIAAYVLVLNGYKNVYHLEGGIYKWFKEGLPSESEEE 484 RS IAAY+LVLNGY NV+HLEGG+Y WFKEGLP ESE+E Sbjct: 191 RSLIAAYLLVLNGYTNVFHLEGGLYSWFKEGLPVESEDE 229 >ref|XP_006413041.1| hypothetical protein EUTSA_v10026171mg [Eutrema salsugineum] gi|557114211|gb|ESQ54494.1| hypothetical protein EUTSA_v10026171mg [Eutrema salsugineum] Length = 226 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +2 Query: 368 RSFIAAYVLVLNGYKNVYHLEGGIYKWFKEGLPSESEEE 484 RS IAAYVLVLNGYKNV+HLEGGIY W KEGLP E+EE+ Sbjct: 188 RSLIAAYVLVLNGYKNVFHLEGGIYTWSKEGLPVETEED 226 >ref|XP_002317802.2| rhodanese-like domain-containing family protein [Populus trichocarpa] gi|550326243|gb|EEE96022.2| rhodanese-like domain-containing family protein [Populus trichocarpa] Length = 239 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +2 Query: 368 RSFIAAYVLVLNGYKNVYHLEGGIYKWFKEGLPSESEE 481 RS IAAY+LVLNGYKNV+HLEGG+Y WFKE LP+ESEE Sbjct: 202 RSLIAAYLLVLNGYKNVFHLEGGLYTWFKEDLPAESEE 239 >gb|AFP55543.1| rhodanese-like domain-containing protein [Rosa rugosa] Length = 232 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +2 Query: 368 RSFIAAYVLVLNGYKNVYHLEGGIYKWFKEGLPSESEEE 484 RS IAAY+LVLNGY NV+HLEGG+Y WFKEGLP ES+EE Sbjct: 190 RSLIAAYLLVLNGYTNVFHLEGGLYSWFKEGLPVESKEE 228 >gb|ABK96337.1| unknown [Populus trichocarpa x Populus deltoides] Length = 239 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +2 Query: 368 RSFIAAYVLVLNGYKNVYHLEGGIYKWFKEGLPSESEE 481 RS IAAY+LVLNGYKNV+HLEGG+Y WFKE LP+ESEE Sbjct: 202 RSLIAAYLLVLNGYKNVFHLEGGLYTWFKEDLPAESEE 239 >ref|XP_007039149.1| Rhodanese/Cell cycle control phosphatase superfamily protein isoform 2, partial [Theobroma cacao] gi|508776394|gb|EOY23650.1| Rhodanese/Cell cycle control phosphatase superfamily protein isoform 2, partial [Theobroma cacao] Length = 177 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +2 Query: 368 RSFIAAYVLVLNGYKNVYHLEGGIYKWFKEGLPSESEE 481 RS IAAY+LVLNGYKNV+HLEGG+ WFKEGLPSESE+ Sbjct: 140 RSLIAAYLLVLNGYKNVFHLEGGLSTWFKEGLPSESED 177 >ref|XP_007039148.1| Rhodanese/Cell cycle control phosphatase superfamily protein isoform 1 [Theobroma cacao] gi|508776393|gb|EOY23649.1| Rhodanese/Cell cycle control phosphatase superfamily protein isoform 1 [Theobroma cacao] Length = 238 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +2 Query: 368 RSFIAAYVLVLNGYKNVYHLEGGIYKWFKEGLPSESEE 481 RS IAAY+LVLNGYKNV+HLEGG+ WFKEGLPSESE+ Sbjct: 201 RSLIAAYLLVLNGYKNVFHLEGGLSTWFKEGLPSESED 238 >gb|EMT05045.1| hypothetical protein F775_26396 [Aegilops tauschii] Length = 226 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +2 Query: 368 RSFIAAYVLVLNGYKNVYHLEGGIYKWFKEGLPSESEEE 484 RS IAAY+LVLNGYKNV+HL+GG+Y WFKE LPSE EE+ Sbjct: 188 RSLIAAYLLVLNGYKNVFHLDGGLYTWFKEDLPSEGEED 226 >ref|XP_004502705.1| PREDICTED: rhodanese-like domain-containing protein 14, chloroplastic-like [Cicer arietinum] Length = 235 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +2 Query: 368 RSFIAAYVLVLNGYKNVYHLEGGIYKWFKEGLPSESEEE 484 RS IAAY+LVLNGY NV+HLEGG+Y WFKE LPS SEEE Sbjct: 197 RSLIAAYLLVLNGYNNVFHLEGGLYSWFKEDLPSVSEEE 235 >ref|XP_002274646.1| PREDICTED: uncharacterized protein LOC100245212 [Vitis vinifera] gi|302143949|emb|CBI23054.3| unnamed protein product [Vitis vinifera] Length = 233 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 368 RSFIAAYVLVLNGYKNVYHLEGGIYKWFKEGLPSESEE 481 RS IAAY+LVLNGY NV+HLEGG+Y WFKEGLPS SEE Sbjct: 196 RSLIAAYLLVLNGYTNVFHLEGGLYTWFKEGLPSVSEE 233 >gb|EMS60178.1| hypothetical protein TRIUR3_11770 [Triticum urartu] Length = 225 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +2 Query: 365 CRSFIAAYVLVLNGYKNVYHLEGGIYKWFKEGLPSESEE 481 C S IAAY+LVLNGYKNV+HL+GG+Y WFKE LPSE E+ Sbjct: 187 CVSLIAAYLLVLNGYKNVFHLDGGLYTWFKEDLPSEEED 225 >ref|NP_001149014.1| rhodanese-like domain containing protein [Zea mays] gi|195610936|gb|ACG27298.1| rhodanese-like domain containing protein [Zea mays] gi|195624004|gb|ACG33832.1| rhodanese-like domain containing protein [Zea mays] gi|414886381|tpg|DAA62395.1| TPA: rhodanese-like domain containing protein [Zea mays] Length = 229 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +2 Query: 368 RSFIAAYVLVLNGYKNVYHLEGGIYKWFKEGLPSESEEE 484 RS IAAY+LVLNGY NVYHLEGG+Y WFKEGLP+ + EE Sbjct: 191 RSLIAAYLLVLNGYSNVYHLEGGLYTWFKEGLPAVAGEE 229 >gb|EXC21396.1| hypothetical protein L484_011837 [Morus notabilis] Length = 254 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +2 Query: 368 RSFIAAYVLVLNGYKNVYHLEGGIYKWFKEGLPSESEE 481 RS IAAY+LVLNGY NV+HLEGG+Y WFKEGLPS +EE Sbjct: 215 RSLIAAYLLVLNGYTNVFHLEGGLYTWFKEGLPSITEE 252