BLASTX nr result
ID: Mentha23_contig00034616
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00034616 (805 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006361257.1| PREDICTED: putative F-box protein At1g49610-... 60 1e-06 ref|XP_006361256.1| PREDICTED: putative F-box protein At1g49610-... 60 1e-06 >ref|XP_006361257.1| PREDICTED: putative F-box protein At1g49610-like isoform X2 [Solanum tuberosum] Length = 385 Score = 59.7 bits (143), Expect = 1e-06 Identities = 46/107 (42%), Positives = 64/107 (59%), Gaps = 7/107 (6%) Frame = +3 Query: 3 SSIRKLTLSYIKLRIPG--NVQLSQLTSLTVEDSKSLSELGMTRLLSGAPVLEELVLLDM 176 SS+R L L Y KL++ NV S L SL+V K L+E M ++LSG P LE L LLD Sbjct: 147 SSMRNLNLQYCKLKLEPSVNVNWSNLVSLSVGYVK-LTERVMGKILSGCPNLECL-LLDF 204 Query: 177 EIGED-YNIRSESLKKLIINTFLSSELRIW----APNLSNIDIGGYA 302 G D I + LKKL IN++ +SE +W AP++ N+++ GY+ Sbjct: 205 IWGFDRLEISNVKLKKLTINSYETSECDVWLEILAPHIQNLELLGYS 251 >ref|XP_006361256.1| PREDICTED: putative F-box protein At1g49610-like isoform X1 [Solanum tuberosum] Length = 484 Score = 59.7 bits (143), Expect = 1e-06 Identities = 46/107 (42%), Positives = 64/107 (59%), Gaps = 7/107 (6%) Frame = +3 Query: 3 SSIRKLTLSYIKLRIPG--NVQLSQLTSLTVEDSKSLSELGMTRLLSGAPVLEELVLLDM 176 SS+R L L Y KL++ NV S L SL+V K L+E M ++LSG P LE L LLD Sbjct: 147 SSMRNLNLQYCKLKLEPSVNVNWSNLVSLSVGYVK-LTERVMGKILSGCPNLECL-LLDF 204 Query: 177 EIGED-YNIRSESLKKLIINTFLSSELRIW----APNLSNIDIGGYA 302 G D I + LKKL IN++ +SE +W AP++ N+++ GY+ Sbjct: 205 IWGFDRLEISNVKLKKLTINSYETSECDVWLEILAPHIQNLELLGYS 251