BLASTX nr result
ID: Mentha23_contig00034607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00034607 (433 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006396990.1| hypothetical protein EUTSA_v10029021mg [Eutr... 72 1e-10 dbj|BAB41214.1| putative transcriptional coactivator [Brassica r... 71 1e-10 gb|EYU23318.1| hypothetical protein MIMGU_mgv1a014887mg [Mimulus... 70 2e-10 ref|XP_006288802.1| hypothetical protein CARUB_v10002126mg [Caps... 70 2e-10 ref|XP_002874654.1| hypothetical protein ARALYDRAFT_489930 [Arab... 70 2e-10 ref|NP_001238108.1| uncharacterized protein LOC100499671 [Glycin... 70 2e-10 ref|NP_192830.1| transcriptional coactivator KELP [Arabidopsis t... 69 7e-10 ref|NP_001238275.1| uncharacterized protein LOC100305633 [Glycin... 68 1e-09 ref|XP_007160184.1| hypothetical protein PHAVU_002G300000g [Phas... 68 2e-09 ref|XP_002266998.1| PREDICTED: RNA polymerase II transcriptional... 68 2e-09 emb|CBI34506.3| unnamed protein product [Vitis vinifera] 68 2e-09 emb|CAN65190.1| hypothetical protein VITISV_032101 [Vitis vinifera] 68 2e-09 ref|XP_006852619.1| hypothetical protein AMTR_s00021p00230560 [A... 67 3e-09 ref|XP_004969691.1| PREDICTED: RNA polymerase II transcriptional... 66 4e-09 ref|XP_004969690.1| PREDICTED: RNA polymerase II transcriptional... 66 4e-09 ref|XP_007208834.1| hypothetical protein PRUPE_ppa025432mg, part... 65 8e-09 gb|AFK46610.1| unknown [Lotus japonicus] 65 8e-09 gb|EXC24698.1| hypothetical protein L484_003140 [Morus notabilis] 65 1e-08 ref|XP_007040567.1| Transcriptional coactivator p15 (PC4) family... 65 1e-08 ref|XP_004245503.1| PREDICTED: RNA polymerase II transcriptional... 65 1e-08 >ref|XP_006396990.1| hypothetical protein EUTSA_v10029021mg [Eutrema salsugineum] gi|557098007|gb|ESQ38443.1| hypothetical protein EUTSA_v10029021mg [Eutrema salsugineum] Length = 168 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = -1 Query: 433 LSDKRRVTLSEFRGKTLVSIREYYKRDGKELPSTKGISV 317 LSDKRRVT+ EFRGKTLVSIREYYK+DGKELP++KGIS+ Sbjct: 104 LSDKRRVTIQEFRGKTLVSIREYYKKDGKELPTSKGISL 142 >dbj|BAB41214.1| putative transcriptional coactivator [Brassica rapa] Length = 165 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = -1 Query: 433 LSDKRRVTLSEFRGKTLVSIREYYKRDGKELPSTKGISV 317 LSDKRRVT+ EFRGK+LVSIREYYK+DGKELPS+KGIS+ Sbjct: 101 LSDKRRVTIQEFRGKSLVSIREYYKKDGKELPSSKGISL 139 >gb|EYU23318.1| hypothetical protein MIMGU_mgv1a014887mg [Mimulus guttatus] Length = 174 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 433 LSDKRRVTLSEFRGKTLVSIREYYKRDGKELPSTKGISV 317 L+DKRRVTLSEF+GKT +SIREYYKRDGKELPS KGIS+ Sbjct: 109 LNDKRRVTLSEFKGKTYLSIREYYKRDGKELPSAKGISL 147 >ref|XP_006288802.1| hypothetical protein CARUB_v10002126mg [Capsella rubella] gi|482557508|gb|EOA21700.1| hypothetical protein CARUB_v10002126mg [Capsella rubella] Length = 167 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = -1 Query: 433 LSDKRRVTLSEFRGKTLVSIREYYKRDGKELPSTKGISV 317 LSDKRRVT+ EF+GKTLVSIREYYK+DGKELP++KGIS+ Sbjct: 103 LSDKRRVTIQEFKGKTLVSIREYYKKDGKELPTSKGISL 141 >ref|XP_002874654.1| hypothetical protein ARALYDRAFT_489930 [Arabidopsis lyrata subsp. lyrata] gi|297320491|gb|EFH50913.1| hypothetical protein ARALYDRAFT_489930 [Arabidopsis lyrata subsp. lyrata] Length = 165 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = -1 Query: 433 LSDKRRVTLSEFRGKTLVSIREYYKRDGKELPSTKGISV 317 LSDKRRVT+ EF+GKTLVSIREYYK+DGKELP++KGIS+ Sbjct: 101 LSDKRRVTIQEFKGKTLVSIREYYKKDGKELPTSKGISL 139 >ref|NP_001238108.1| uncharacterized protein LOC100499671 [Glycine max] gi|255625681|gb|ACU13185.1| unknown [Glycine max] Length = 163 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = -1 Query: 433 LSDKRRVTLSEFRGKTLVSIREYYKRDGKELPSTKGISV 317 LSDKRRVT+ +FRGKTLVSIREYYK+DGKELP++KGIS+ Sbjct: 100 LSDKRRVTIQDFRGKTLVSIREYYKKDGKELPTSKGISL 138 >ref|NP_192830.1| transcriptional coactivator KELP [Arabidopsis thaliana] gi|145333013|ref|NP_001078372.1| transcriptional coactivator KELP [Arabidopsis thaliana] gi|37079408|sp|O65155.1|KELP_ARATH RecName: Full=RNA polymerase II transcriptional coactivator KELP gi|2997686|gb|AAC08575.1| putative transcriptional co-activator [Arabidopsis thaliana] gi|3513735|gb|AAC33951.1| contains similarity to RNA polymerase II transcription cofactor p15 [Arabidopsis thaliana] gi|4539366|emb|CAB40060.1| putative protein [Arabidopsis thaliana] gi|7267790|emb|CAB81193.1| putative protein [Arabidopsis thaliana] gi|21554027|gb|AAM63108.1| putative transcriptional coactivator [Arabidopsis thaliana] gi|29028806|gb|AAO64782.1| At4g10920 [Arabidopsis thaliana] gi|110736559|dbj|BAF00245.1| hypothetical protein [Arabidopsis thaliana] gi|110738319|dbj|BAF01087.1| hypothetical protein [Arabidopsis thaliana] gi|332657543|gb|AEE82943.1| transcriptional coactivator KELP [Arabidopsis thaliana] gi|332657544|gb|AEE82944.1| transcriptional coactivator KELP [Arabidopsis thaliana] Length = 165 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/39 (79%), Positives = 38/39 (97%) Frame = -1 Query: 433 LSDKRRVTLSEFRGKTLVSIREYYKRDGKELPSTKGISV 317 LSDKRRVT+ EF+GK+LVSIREYYK+DGKELP++KGIS+ Sbjct: 101 LSDKRRVTIQEFKGKSLVSIREYYKKDGKELPTSKGISL 139 >ref|NP_001238275.1| uncharacterized protein LOC100305633 [Glycine max] gi|255626145|gb|ACU13417.1| unknown [Glycine max] Length = 166 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = -1 Query: 433 LSDKRRVTLSEFRGKTLVSIREYYKRDGKELPSTKGISV 317 LSDKRRV + +FRGKTLVSIREYYK+DGKELP++KGIS+ Sbjct: 103 LSDKRRVPIQDFRGKTLVSIREYYKKDGKELPTSKGISL 141 >ref|XP_007160184.1| hypothetical protein PHAVU_002G300000g [Phaseolus vulgaris] gi|561033599|gb|ESW32178.1| hypothetical protein PHAVU_002G300000g [Phaseolus vulgaris] Length = 161 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/39 (76%), Positives = 38/39 (97%) Frame = -1 Query: 433 LSDKRRVTLSEFRGKTLVSIREYYKRDGKELPSTKGISV 317 LS+KRRVT+ +FRGKTLVSIREYYK+DGK+LP++KGIS+ Sbjct: 98 LSEKRRVTIQDFRGKTLVSIREYYKKDGKDLPTSKGISL 136 >ref|XP_002266998.1| PREDICTED: RNA polymerase II transcriptional coactivator KELP-like [Vitis vinifera] Length = 187 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/39 (76%), Positives = 38/39 (97%) Frame = -1 Query: 433 LSDKRRVTLSEFRGKTLVSIREYYKRDGKELPSTKGISV 317 LSD+RRVT+ +FRGKTLVSIRE+Y++DGKELPS+KGIS+ Sbjct: 122 LSDRRRVTIQDFRGKTLVSIREFYRKDGKELPSSKGISL 160 >emb|CBI34506.3| unnamed protein product [Vitis vinifera] Length = 142 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/39 (76%), Positives = 38/39 (97%) Frame = -1 Query: 433 LSDKRRVTLSEFRGKTLVSIREYYKRDGKELPSTKGISV 317 LSD+RRVT+ +FRGKTLVSIRE+Y++DGKELPS+KGIS+ Sbjct: 77 LSDRRRVTIQDFRGKTLVSIREFYRKDGKELPSSKGISL 115 >emb|CAN65190.1| hypothetical protein VITISV_032101 [Vitis vinifera] Length = 320 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/39 (76%), Positives = 38/39 (97%) Frame = -1 Query: 433 LSDKRRVTLSEFRGKTLVSIREYYKRDGKELPSTKGISV 317 LSD+RRVT+ +FRGKTLVSIRE+Y++DGKELPS+KGIS+ Sbjct: 200 LSDRRRVTIQDFRGKTLVSIREFYRKDGKELPSSKGISL 238 >ref|XP_006852619.1| hypothetical protein AMTR_s00021p00230560 [Amborella trichopoda] gi|548856230|gb|ERN14086.1| hypothetical protein AMTR_s00021p00230560 [Amborella trichopoda] Length = 161 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/39 (76%), Positives = 38/39 (97%) Frame = -1 Query: 433 LSDKRRVTLSEFRGKTLVSIREYYKRDGKELPSTKGISV 317 LS+KR+VT+ +FRGKTLVSIREYY++DGKELPS+KGIS+ Sbjct: 96 LSNKRKVTIQDFRGKTLVSIREYYEKDGKELPSSKGISL 134 >ref|XP_004969691.1| PREDICTED: RNA polymerase II transcriptional coactivator KELP-like isoform X2 [Setaria italica] Length = 181 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = -1 Query: 433 LSDKRRVTLSEFRGKTLVSIREYYKRDGKELPSTKGISV 317 LS KRRVTLSEF+G+TLVSIRE+Y +DGKELPS+KGIS+ Sbjct: 117 LSSKRRVTLSEFKGRTLVSIREFYLKDGKELPSSKGISM 155 >ref|XP_004969690.1| PREDICTED: RNA polymerase II transcriptional coactivator KELP-like isoform X1 [Setaria italica] Length = 206 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -1 Query: 433 LSDKRRVTLSEFRGKTLVSIREYYKRDGKELPSTKGISVLP 311 LS KRRVTLSEF+G+TLVSIRE+Y +DGKELPS+KG S LP Sbjct: 117 LSSKRRVTLSEFKGRTLVSIREFYLKDGKELPSSKGDSDLP 157 >ref|XP_007208834.1| hypothetical protein PRUPE_ppa025432mg, partial [Prunus persica] gi|462404569|gb|EMJ10033.1| hypothetical protein PRUPE_ppa025432mg, partial [Prunus persica] Length = 149 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -1 Query: 433 LSDKRRVTLSEFRGKTLVSIREYYKRDGKELPSTKGISV 317 LS KR+VTL EFRGK+LVSIRE+Y +DGKELP+TKGIS+ Sbjct: 100 LSSKRKVTLQEFRGKSLVSIREFYSKDGKELPTTKGISL 138 >gb|AFK46610.1| unknown [Lotus japonicus] Length = 160 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/39 (71%), Positives = 38/39 (97%) Frame = -1 Query: 433 LSDKRRVTLSEFRGKTLVSIREYYKRDGKELPSTKGISV 317 LS+KR+VT+ +FRGKTLVSIREYY++DGK+LP++KGIS+ Sbjct: 96 LSEKRKVTIQDFRGKTLVSIREYYRKDGKDLPTSKGISL 134 >gb|EXC24698.1| hypothetical protein L484_003140 [Morus notabilis] Length = 162 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/39 (74%), Positives = 37/39 (94%) Frame = -1 Query: 433 LSDKRRVTLSEFRGKTLVSIREYYKRDGKELPSTKGISV 317 LS+KR+VT+ +FRGKTLVSIREY+K+DGKELP+ KGIS+ Sbjct: 99 LSEKRKVTIQDFRGKTLVSIREYFKKDGKELPTFKGISM 137 >ref|XP_007040567.1| Transcriptional coactivator p15 (PC4) family protein (KELP) [Theobroma cacao] gi|508777812|gb|EOY25068.1| Transcriptional coactivator p15 (PC4) family protein (KELP) [Theobroma cacao] Length = 158 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/39 (74%), Positives = 37/39 (94%) Frame = -1 Query: 433 LSDKRRVTLSEFRGKTLVSIREYYKRDGKELPSTKGISV 317 LS++RRV + EFRGK+LVSIRE+YK+DGKELPS+KGIS+ Sbjct: 93 LSERRRVMIQEFRGKSLVSIREFYKKDGKELPSSKGISL 131 >ref|XP_004245503.1| PREDICTED: RNA polymerase II transcriptional coactivator KELP-like [Solanum lycopersicum] Length = 175 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/39 (74%), Positives = 37/39 (94%) Frame = -1 Query: 433 LSDKRRVTLSEFRGKTLVSIREYYKRDGKELPSTKGISV 317 LS KRRVT+++FRGKTLVSIREYY ++GKELP++KGIS+ Sbjct: 111 LSQKRRVTVTDFRGKTLVSIREYYSKEGKELPTSKGISL 149