BLASTX nr result
ID: Mentha23_contig00034587
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00034587 (366 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46638.1| hypothetical protein MIMGU_mgv1a009369mg [Mimulus... 65 7e-09 gb|AFA35961.1| gid1-like gibberellin receptor [Nicotiana attenuata] 65 1e-08 ref|XP_006362976.1| PREDICTED: gibberellin receptor GID1B-like [... 64 2e-08 gb|AGN72649.1| gibberellin receptor GID1B [Petunia x hybrida] 64 2e-08 ref|XP_004240525.1| PREDICTED: gibberellin receptor GID1B-like i... 64 2e-08 gb|AGN95005.1| gibberellin receptor 1b [Prunus salicina] gi|5117... 64 3e-08 ref|XP_007200346.1| hypothetical protein PRUPE_ppa008128mg [Prun... 64 3e-08 ref|XP_007050733.1| Alpha/beta-Hydrolases superfamily protein is... 63 4e-08 ref|XP_004290704.1| PREDICTED: gibberellin receptor GID1B-like [... 63 4e-08 gb|ACN86356.1| GID1-1 [Gossypium hirsutum] 63 4e-08 ref|XP_002302813.1| hypothetical protein POPTR_0002s22840g [Popu... 63 4e-08 gb|ABG89394.1| gibberellic acid receptor [Gossypium hirsutum] 63 4e-08 gb|AGU38487.1| GID1b [Camellia sinensis] 63 5e-08 gb|AFD32892.1| GID1c [Malus domestica] 62 6e-08 emb|CAN68335.1| hypothetical protein VITISV_040540 [Vitis vinifera] 62 6e-08 gb|ABB89021.1| CXE carboxylesterase [Actinidia deliciosa] 62 6e-08 gb|ACN86357.1| GID1-2 [Gossypium hirsutum] 62 8e-08 ref|XP_002524767.1| Gibberellin receptor GID1, putative [Ricinus... 62 8e-08 gb|ABQ96123.1| gibberellic acid receptor-b [Gossypium hirsutum] 62 8e-08 ref|XP_006444187.1| hypothetical protein CICLE_v10020963mg [Citr... 62 1e-07 >gb|EYU46638.1| hypothetical protein MIMGU_mgv1a009369mg [Mimulus guttatus] Length = 344 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 271 MAGSNEVNANESTRVVPLNTWILISNFKLAYN 366 MAGSNEVNANES RVVPLNTWILISNFKLAYN Sbjct: 1 MAGSNEVNANESKRVVPLNTWILISNFKLAYN 32 >gb|AFA35961.1| gid1-like gibberellin receptor [Nicotiana attenuata] Length = 345 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 271 MAGSNEVNANESTRVVPLNTWILISNFKLAYN 366 MAGSNE+NANES RVVPLNTWILISNFKLAYN Sbjct: 1 MAGSNEINANESKRVVPLNTWILISNFKLAYN 32 >ref|XP_006362976.1| PREDICTED: gibberellin receptor GID1B-like [Solanum tuberosum] Length = 345 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 271 MAGSNEVNANESTRVVPLNTWILISNFKLAYN 366 MAGSNE+NANES RVVPLNTWILISNFKL+YN Sbjct: 1 MAGSNEINANESKRVVPLNTWILISNFKLSYN 32 >gb|AGN72649.1| gibberellin receptor GID1B [Petunia x hybrida] Length = 345 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 271 MAGSNEVNANESTRVVPLNTWILISNFKLAYN 366 MAGSNE+NANES RVVPLNTWILISNFKL+YN Sbjct: 1 MAGSNEINANESKRVVPLNTWILISNFKLSYN 32 >ref|XP_004240525.1| PREDICTED: gibberellin receptor GID1B-like isoform 1 [Solanum lycopersicum] Length = 345 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 271 MAGSNEVNANESTRVVPLNTWILISNFKLAYN 366 MAGSNE+NANES RVVPLNTWILISNFKL+YN Sbjct: 1 MAGSNEINANESKRVVPLNTWILISNFKLSYN 32 >gb|AGN95005.1| gibberellin receptor 1b [Prunus salicina] gi|511782930|gb|AGN95007.1| gibberellin receptor 1b [Prunus salicina] Length = 344 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 271 MAGSNEVNANESTRVVPLNTWILISNFKLAYN 366 MAGSNEVN NES RVVPLNTW+LISNFKLAYN Sbjct: 1 MAGSNEVNVNESKRVVPLNTWVLISNFKLAYN 32 >ref|XP_007200346.1| hypothetical protein PRUPE_ppa008128mg [Prunus persica] gi|595793197|ref|XP_007200347.1| hypothetical protein PRUPE_ppa008128mg [Prunus persica] gi|462395746|gb|EMJ01545.1| hypothetical protein PRUPE_ppa008128mg [Prunus persica] gi|462395747|gb|EMJ01546.1| hypothetical protein PRUPE_ppa008128mg [Prunus persica] Length = 344 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 271 MAGSNEVNANESTRVVPLNTWILISNFKLAYN 366 MAGSNEVN NES RVVPLNTW+LISNFKLAYN Sbjct: 1 MAGSNEVNVNESKRVVPLNTWVLISNFKLAYN 32 >ref|XP_007050733.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma cacao] gi|590718049|ref|XP_007050734.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma cacao] gi|508702994|gb|EOX94890.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma cacao] gi|508702995|gb|EOX94891.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma cacao] Length = 344 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 271 MAGSNEVNANESTRVVPLNTWILISNFKLAYN 366 MAGSNEVN NES RVVPLNTW+LISNFKLAYN Sbjct: 1 MAGSNEVNLNESRRVVPLNTWVLISNFKLAYN 32 >ref|XP_004290704.1| PREDICTED: gibberellin receptor GID1B-like [Fragaria vesca subsp. vesca] Length = 344 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 271 MAGSNEVNANESTRVVPLNTWILISNFKLAYN 366 MAGSNEVN NES RVVPLNTW+LISNFKLAYN Sbjct: 1 MAGSNEVNLNESKRVVPLNTWVLISNFKLAYN 32 >gb|ACN86356.1| GID1-1 [Gossypium hirsutum] Length = 344 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 271 MAGSNEVNANESTRVVPLNTWILISNFKLAYN 366 MAGSNEVN NES RVVPLNTW+LISNFKLAYN Sbjct: 1 MAGSNEVNLNESKRVVPLNTWVLISNFKLAYN 32 >ref|XP_002302813.1| hypothetical protein POPTR_0002s22840g [Populus trichocarpa] gi|222844539|gb|EEE82086.1| hypothetical protein POPTR_0002s22840g [Populus trichocarpa] Length = 344 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 271 MAGSNEVNANESTRVVPLNTWILISNFKLAYN 366 MAGSNEVN NES RVVPLNTW+LISNFKLAYN Sbjct: 1 MAGSNEVNLNESKRVVPLNTWVLISNFKLAYN 32 >gb|ABG89394.1| gibberellic acid receptor [Gossypium hirsutum] Length = 344 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 271 MAGSNEVNANESTRVVPLNTWILISNFKLAYN 366 MAGSNEVN NES RVVPLNTW+LISNFKLAYN Sbjct: 1 MAGSNEVNLNESKRVVPLNTWVLISNFKLAYN 32 >gb|AGU38487.1| GID1b [Camellia sinensis] Length = 345 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 271 MAGSNEVNANESTRVVPLNTWILISNFKLAYN 366 MAGSNE+NANES RVVPLNTWILISN KLAYN Sbjct: 1 MAGSNEINANESKRVVPLNTWILISNLKLAYN 32 >gb|AFD32892.1| GID1c [Malus domestica] Length = 346 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 271 MAGSNEVNANESTRVVPLNTWILISNFKLAYN 366 MAGSNEVN NES +VVPLNTW+LISNFKLAYN Sbjct: 1 MAGSNEVNVNESKKVVPLNTWVLISNFKLAYN 32 >emb|CAN68335.1| hypothetical protein VITISV_040540 [Vitis vinifera] Length = 435 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +1 Query: 259 KRLLMAGSNEVNANESTRVVPLNTWILISNFKLAYN 366 K MAGSNEVN +ES RVVPLNTWILISNFKLAYN Sbjct: 364 KARFMAGSNEVNLSESKRVVPLNTWILISNFKLAYN 399 >gb|ABB89021.1| CXE carboxylesterase [Actinidia deliciosa] Length = 346 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 271 MAGSNEVNANESTRVVPLNTWILISNFKLAYN 366 MAGSNE+N NES +VVPLNTWILISNFKLAYN Sbjct: 1 MAGSNEINVNESKKVVPLNTWILISNFKLAYN 32 >gb|ACN86357.1| GID1-2 [Gossypium hirsutum] Length = 344 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 271 MAGSNEVNANESTRVVPLNTWILISNFKLAYN 366 MAGSNEVN NES RVVPLNTW+LISNFKL+YN Sbjct: 1 MAGSNEVNLNESKRVVPLNTWVLISNFKLSYN 32 >ref|XP_002524767.1| Gibberellin receptor GID1, putative [Ricinus communis] gi|223535951|gb|EEF37610.1| Gibberellin receptor GID1, putative [Ricinus communis] Length = 345 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 271 MAGSNEVNANESTRVVPLNTWILISNFKLAYN 366 MAG+NEVN NES RVVPLNTW+LISNFKLAYN Sbjct: 1 MAGTNEVNLNESKRVVPLNTWVLISNFKLAYN 32 >gb|ABQ96123.1| gibberellic acid receptor-b [Gossypium hirsutum] Length = 344 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 271 MAGSNEVNANESTRVVPLNTWILISNFKLAYN 366 MAGSNEVN NES RVVPLNTW+LISNFKL+YN Sbjct: 1 MAGSNEVNLNESKRVVPLNTWVLISNFKLSYN 32 >ref|XP_006444187.1| hypothetical protein CICLE_v10020963mg [Citrus clementina] gi|568852325|ref|XP_006479828.1| PREDICTED: gibberellin receptor GID1B-like [Citrus sinensis] gi|557546449|gb|ESR57427.1| hypothetical protein CICLE_v10020963mg [Citrus clementina] Length = 344 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +1 Query: 271 MAGSNEVNANESTRVVPLNTWILISNFKLAYN 366 MAG NEVN NES RVVPLNTW+LISNFKLAYN Sbjct: 1 MAGGNEVNLNESKRVVPLNTWVLISNFKLAYN 32