BLASTX nr result
ID: Mentha23_contig00034576
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00034576 (530 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB65570.1| hypothetical protein L484_025836 [Morus notabilis] 99 6e-19 ref|XP_002535249.1| conserved hypothetical protein [Ricinus comm... 78 1e-12 ref|XP_003588305.1| hypothetical protein MTR_1g005670 [Medicago ... 67 2e-09 >gb|EXB65570.1| hypothetical protein L484_025836 [Morus notabilis] Length = 176 Score = 99.0 bits (245), Expect = 6e-19 Identities = 63/124 (50%), Positives = 74/124 (59%), Gaps = 28/124 (22%) Frame = -2 Query: 514 SLLAGAGVETSERALRERIVWRGEKFPVGVSDPPGIHLLVEEV----------------- 386 S LAGAG+ETSERALRERIVWRGE+FPVGVS PPG+HL+VEE+ Sbjct: 58 SWLAGAGMETSERALRERIVWRGERFPVGVSGPPGLHLIVEELVPVRLFGTGRQPTYMKR 117 Query: 385 ----GFLDMLVSRQ*KKGNS------VRATDAL-IMTPCCQSCNILAVMLAGFGQFYLLL 239 GFLD+ VSR+ KK S + D+L + CC A GFG+FYLLL Sbjct: 118 RREGGFLDIKVSRRSKKATSGSNRCFGHSVDSLPPVRACCH-----AGKSRGFGRFYLLL 172 Query: 238 DLNQ 227 DLNQ Sbjct: 173 DLNQ 176 >ref|XP_002535249.1| conserved hypothetical protein [Ricinus communis] gi|223523659|gb|EEF27136.1| conserved hypothetical protein [Ricinus communis] Length = 55 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +2 Query: 404 VDTRRVGNPNGKLFTAPHDSFAKRSLRRFHSCPRKQRGFKI 526 V T+ GNPNGK FT PHDSFAKRSLRRFHSCPRKQRGFKI Sbjct: 1 VKTKGAGNPNGKPFTTPHDSFAKRSLRRFHSCPRKQRGFKI 41 >ref|XP_003588305.1| hypothetical protein MTR_1g005670 [Medicago truncatula] gi|355477353|gb|AES58556.1| hypothetical protein MTR_1g005670 [Medicago truncatula] Length = 250 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/47 (65%), Positives = 34/47 (72%) Frame = -2 Query: 529 WYLETSLLAGAGVETSERALRERIVWRGEKFPVGVSDPPGIHLLVEE 389 W L G SERALRERIVWRGE+FPVGVS PPG+HL+VEE Sbjct: 118 WLQRVRSLEDLGRSASERALRERIVWRGERFPVGVSGPPGLHLIVEE 164