BLASTX nr result
ID: Mentha23_contig00034514
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00034514 (358 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18734.1| hypothetical protein MIMGU_mgv1a005684mg [Mimulus... 62 1e-07 ref|XP_002278289.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 56 5e-06 >gb|EYU18734.1| hypothetical protein MIMGU_mgv1a005684mg [Mimulus guttatus] Length = 474 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/50 (64%), Positives = 40/50 (80%), Gaps = 2/50 (4%) Frame = -1 Query: 358 FQILPKDTASVNHFLSLLPQSMTI--KDSSDSHEFLREQIQDFLLSDSDD 215 FQILPKD +S+ +F SLLPQSMT K ++D+ + LREQIQD LLS+SDD Sbjct: 422 FQILPKDNSSMEYFCSLLPQSMTTLPKYTNDNQKLLREQIQDCLLSESDD 471 >ref|XP_002278289.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 2 [Vitis vinifera] gi|297739656|emb|CBI29838.3| unnamed protein product [Vitis vinifera] Length = 468 Score = 56.2 bits (134), Expect = 5e-06 Identities = 32/51 (62%), Positives = 36/51 (70%), Gaps = 3/51 (5%) Frame = -1 Query: 358 FQILPKDTASVNHFLSLLPQSMTI--KDSSDS-HEFLREQIQDFLLSDSDD 215 FQILPK+ S+ HF SLLPQ + KD S S LREQIQDFLLSDS+D Sbjct: 416 FQILPKEPVSMEHFYSLLPQQFVVQAKDRSFSMQRQLREQIQDFLLSDSED 466