BLASTX nr result
ID: Mentha23_contig00034369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00034369 (413 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS65573.1| hypothetical protein M569_09204, partial [Genlise... 58 1e-06 >gb|EPS65573.1| hypothetical protein M569_09204, partial [Genlisea aurea] Length = 965 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/49 (59%), Positives = 33/49 (67%) Frame = -3 Query: 147 APKVFDRFYXXXXXXXXXXXXXXXSNYQRRLDYMLQFLDRKLSTSSSPD 1 +P+VFDRFY SNYQRRLDYML+FLDRKLSTS+ PD Sbjct: 19 SPRVFDRFYSSSSSEDEEETGGSSSNYQRRLDYMLEFLDRKLSTSAVPD 67