BLASTX nr result
ID: Mentha23_contig00034184
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00034184 (331 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18177.1| hypothetical protein MIMGU_mgv1a000552mg [Mimulus... 94 2e-17 ref|XP_002319149.1| ankyrin repeat family protein [Populus trich... 67 3e-09 ref|XP_007030056.1| Ankyrin repeat family protein / regulator of... 60 3e-07 ref|XP_007030055.1| Ankyrin repeat family protein / regulator of... 60 3e-07 >gb|EYU18177.1| hypothetical protein MIMGU_mgv1a000552mg [Mimulus guttatus] Length = 1081 Score = 94.0 bits (232), Expect = 2e-17 Identities = 53/92 (57%), Positives = 63/92 (68%), Gaps = 1/92 (1%) Frame = +1 Query: 4 KEGESSVAIDSEPVMMKGFVDAEVREEATKVQEKAADSGSSVEIQDTRASKSHSK-KAVG 180 +E S +A+D+E MKGF+DAE ++EK DS S EIQ++R S +S KA G Sbjct: 800 EEEPSDIAVDAETSTMKGFLDAEAEVPEDTIKEK--DSVSVTEIQESRVSPFYSNNKAFG 857 Query: 181 DGPLGATASPTASKKKNRKGGLSMFLSGALDD 276 D P TASPT SKKKNRKGGLSMFLSGALDD Sbjct: 858 DAPHSKTASPTTSKKKNRKGGLSMFLSGALDD 889 >ref|XP_002319149.1| ankyrin repeat family protein [Populus trichocarpa] gi|222857525|gb|EEE95072.1| ankyrin repeat family protein [Populus trichocarpa] Length = 1075 Score = 66.6 bits (161), Expect = 3e-09 Identities = 40/93 (43%), Positives = 52/93 (55%), Gaps = 1/93 (1%) Frame = +1 Query: 1 QKEGESS-VAIDSEPVMMKGFVDAEVREEATKVQEKAADSGSSVEIQDTRASKSHSKKAV 177 Q+E S+ + D+E +K F+D EV + T +E+ GS V KK+ Sbjct: 793 QREMPSAFTSTDAESSSVKNFMDVEVSQFPTNKEEETTFGGSVVNRTSKEIGFFVQKKSG 852 Query: 178 GDGPLGATASPTASKKKNRKGGLSMFLSGALDD 276 D P +SP SKKKNRKGGLSMFLSGALD+ Sbjct: 853 SDLPKNKISSPAVSKKKNRKGGLSMFLSGALDE 885 >ref|XP_007030056.1| Ankyrin repeat family protein / regulator of chromosome condensation (RCC1) family protein isoform 2 [Theobroma cacao] gi|508718661|gb|EOY10558.1| Ankyrin repeat family protein / regulator of chromosome condensation (RCC1) family protein isoform 2 [Theobroma cacao] Length = 1078 Score = 60.1 bits (144), Expect = 3e-07 Identities = 35/84 (41%), Positives = 46/84 (54%) Frame = +1 Query: 25 AIDSEPVMMKGFVDAEVREEATKVQEKAADSGSSVEIQDTRASKSHSKKAVGDGPLGATA 204 A + EP +K F D E+ + T +E A G+ + +S KK ++ Sbjct: 803 ASNIEPYSVKDFSDIEIPQVLTNKEENAMSEGTMADQASKESSFIVQKKDSSVPAKDKSS 862 Query: 205 SPTASKKKNRKGGLSMFLSGALDD 276 TA+KKKNRKGGLSMFLSGALDD Sbjct: 863 LQTATKKKNRKGGLSMFLSGALDD 886 >ref|XP_007030055.1| Ankyrin repeat family protein / regulator of chromosome condensation (RCC1) family protein isoform 1 [Theobroma cacao] gi|508718660|gb|EOY10557.1| Ankyrin repeat family protein / regulator of chromosome condensation (RCC1) family protein isoform 1 [Theobroma cacao] Length = 1077 Score = 60.1 bits (144), Expect = 3e-07 Identities = 35/84 (41%), Positives = 46/84 (54%) Frame = +1 Query: 25 AIDSEPVMMKGFVDAEVREEATKVQEKAADSGSSVEIQDTRASKSHSKKAVGDGPLGATA 204 A + EP +K F D E+ + T +E A G+ + +S KK ++ Sbjct: 803 ASNIEPYSVKDFSDIEIPQVLTNKEENAMSEGTMADQASKESSFIVQKKDSSVPAKDKSS 862 Query: 205 SPTASKKKNRKGGLSMFLSGALDD 276 TA+KKKNRKGGLSMFLSGALDD Sbjct: 863 LQTATKKKNRKGGLSMFLSGALDD 886