BLASTX nr result
ID: Mentha23_contig00034132
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00034132 (481 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26655.1| hypothetical protein MIMGU_mgv1a007499mg [Mimulus... 63 5e-08 ref|XP_004246332.1| PREDICTED: uncharacterized protein LOC101251... 57 4e-06 >gb|EYU26655.1| hypothetical protein MIMGU_mgv1a007499mg [Mimulus guttatus] Length = 405 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/44 (56%), Positives = 35/44 (79%) Frame = +3 Query: 3 GPDRVLETWDTAKVISVFEDWDSPDFQDVVEEEFVSDSSLLIAE 134 GPDR+LETWDT K I VFEDWD+P+ Q + EE+ ++D +L+ +E Sbjct: 165 GPDRILETWDTDKTIIVFEDWDNPELQHIFEEDDLNDETLIYSE 208 >ref|XP_004246332.1| PREDICTED: uncharacterized protein LOC101251213 [Solanum lycopersicum] Length = 423 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/46 (52%), Positives = 33/46 (71%) Frame = +3 Query: 3 GPDRVLETWDTAKVISVFEDWDSPDFQDVVEEEFVSDSSLLIAEGV 140 GPDR+L+TW+T K I+V EDWD+ + Q +VEEE +LIAE + Sbjct: 158 GPDRILQTWETNKTITVSEDWDNAELQTIVEEEPAVSPEILIAENL 203