BLASTX nr result
ID: Mentha23_contig00034101
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00034101 (374 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24771.1| hypothetical protein MIMGU_mgv1a007144mg [Mimulus... 57 3e-06 >gb|EYU24771.1| hypothetical protein MIMGU_mgv1a007144mg [Mimulus guttatus] Length = 417 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/78 (39%), Positives = 40/78 (51%), Gaps = 1/78 (1%) Frame = +1 Query: 142 MANVWIPNGECVTSINNSIICMELA-FFTNYDEQSFKIANQVHWIHVQTRKGFVGMVLAS 318 M VW C + + S+ CMEL F + + + + H+ TRKG GMVLAS Sbjct: 1 MVQVWATCTRCPSEKDISLNCMELTDFMQELALEESIYSTMLEFSHIHTRKGITGMVLAS 60 Query: 319 ENKSCFCRNLYEFGIADQ 372 ENKSCF R F I +Q Sbjct: 61 ENKSCFFRTSCHFSIVEQ 78