BLASTX nr result
ID: Mentha23_contig00033968
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00033968 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40782.1| hypothetical protein MIMGU_mgv1a020244mg [Mimulus... 64 2e-08 gb|EYU40780.1| hypothetical protein MIMGU_mgv1a005995mg [Mimulus... 64 2e-08 gb|EYU40783.1| hypothetical protein MIMGU_mgv1a0215072mg, partia... 59 5e-07 ref|XP_006344303.1| PREDICTED: probable receptor-like protein ki... 57 3e-06 >gb|EYU40782.1| hypothetical protein MIMGU_mgv1a020244mg [Mimulus guttatus] Length = 576 Score = 64.3 bits (155), Expect = 2e-08 Identities = 36/76 (47%), Positives = 43/76 (56%), Gaps = 8/76 (10%) Frame = +1 Query: 124 LGGAYLLSRNFSSDPSKSNIWGKHA--------EAKDGYEKDIEFFLKNNGNLAPIRYKY 279 L Y+L N S + S+ + G E K EKDIE FLKNNGNLAP RY+Y Sbjct: 192 LTSEYILEWNVSENCSECHRGGGQCLTNNIGEFECKSADEKDIELFLKNNGNLAPKRYRY 251 Query: 280 STIKKITNSFSEKLGR 327 S +KK T SF E LG+ Sbjct: 252 SDVKKFTKSFGESLGK 267 >gb|EYU40780.1| hypothetical protein MIMGU_mgv1a005995mg [Mimulus guttatus] Length = 461 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 205 KDGY-EKDIEFFLKNNGNLAPIRYKYSTIKKITNSFSEKLGR 327 K G+ EKDIE FLKNNGNLAP RYKYS IKK+T SFSE LG+ Sbjct: 120 KPGFNEKDIELFLKNNGNLAPKRYKYSDIKKMTKSFSESLGK 161 >gb|EYU40783.1| hypothetical protein MIMGU_mgv1a0215072mg, partial [Mimulus guttatus] Length = 344 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 223 DIEFFLKNNGNLAPIRYKYSTIKKITNSFSEKLGR 327 DIE FLKNNGNLAP R+KYS IKK+T SFSE LG+ Sbjct: 1 DIELFLKNNGNLAPTRFKYSDIKKMTKSFSESLGK 35 >ref|XP_006344303.1| PREDICTED: probable receptor-like protein kinase At1g67000-like [Solanum tuberosum] Length = 629 Score = 57.0 bits (136), Expect = 3e-06 Identities = 45/117 (38%), Positives = 59/117 (50%), Gaps = 9/117 (7%) Frame = +1 Query: 4 RFYCR-TDQSRWKLIIAICIPIAAV--------LLFLLACFILWQRKKRLGGAYLLSRNF 156 +F C TDQ + K + I I + A +L LL CF RKK YL Sbjct: 226 KFLCSVTDQGKGKHLRRIWIIVLATVAVFGCIGILILLFCF----RKKIFWHKYL----- 276 Query: 157 SSDPSKSNIWGKHAEAKDGYEKDIEFFLKNNGNLAPIRYKYSTIKKITNSFSEKLGR 327 W +EA+D ++IE FLKNNG AP+RY YS IK++T+SF KLG+ Sbjct: 277 -------RFW--ESEAED--HRNIEAFLKNNGPYAPMRYSYSDIKRMTSSFKNKLGQ 322