BLASTX nr result
ID: Mentha23_contig00033930
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00033930 (511 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268218.1| PREDICTED: nifU-like protein 3, chloroplasti... 64 2e-08 gb|EYU37351.1| hypothetical protein MIMGU_mgv1a012936mg [Mimulus... 64 2e-08 gb|EPS68774.1| hypothetical protein M569_05996, partial [Genlise... 63 5e-08 ref|XP_006656418.1| PREDICTED: nifU-like protein 3, chloroplasti... 61 1e-07 gb|EXB55373.1| NifU-like protein 3 [Morus notabilis] 60 2e-07 ref|XP_002532084.1| Nitrogen fixation protein nifU, putative [Ri... 60 2e-07 ref|XP_007014296.1| NFU domain protein 3 isoform 6 [Theobroma ca... 60 4e-07 ref|XP_007014295.1| NFU domain protein 3 isoform 5 [Theobroma ca... 60 4e-07 ref|XP_007014293.1| NFU domain protein 3 isoform 3, partial [The... 60 4e-07 ref|XP_007014291.1| NFU domain protein 3 isoform 1 [Theobroma ca... 60 4e-07 ref|XP_004148324.1| PREDICTED: nifU-like protein 3, chloroplasti... 60 4e-07 ref|XP_006356915.1| PREDICTED: nifU-like protein 3, chloroplasti... 59 5e-07 ref|XP_006845689.1| hypothetical protein AMTR_s00019p00236430 [A... 59 5e-07 ref|XP_004240148.1| PREDICTED: nifU-like protein 3, chloroplasti... 59 5e-07 ref|XP_006453321.1| hypothetical protein CICLE_v10009375mg [Citr... 59 7e-07 ref|XP_007223846.1| hypothetical protein PRUPE_ppa010743mg [Prun... 59 9e-07 ref|NP_001058443.1| Os06g0694500 [Oryza sativa Japonica Group] g... 58 1e-06 ref|XP_004296460.1| PREDICTED: nifU-like protein 3, chloroplasti... 57 2e-06 ref|XP_007138803.1| hypothetical protein PHAVU_009G238700g [Phas... 57 3e-06 ref|XP_006381779.1| hypothetical protein POPTR_0006s17930g [Popu... 57 3e-06 >ref|XP_002268218.1| PREDICTED: nifU-like protein 3, chloroplastic [Vitis vinifera] gi|297735420|emb|CBI17860.3| unnamed protein product [Vitis vinifera] Length = 237 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 511 RDKIPEIEAVEQILDTETGLELNEENVEKVINLIFPF 401 RDKIPEIEAVEQILDTETGLELNEENVEKV+ I P+ Sbjct: 145 RDKIPEIEAVEQILDTETGLELNEENVEKVLAEIRPY 181 >gb|EYU37351.1| hypothetical protein MIMGU_mgv1a012936mg [Mimulus guttatus] Length = 235 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -1 Query: 511 RDKIPEIEAVEQILDTETGLELNEENVEKVINLIFPF 401 RDKIPEIE+VEQILDTETGLELNEENVEK+++ I P+ Sbjct: 144 RDKIPEIESVEQILDTETGLELNEENVEKILSEIRPY 180 >gb|EPS68774.1| hypothetical protein M569_05996, partial [Genlisea aurea] Length = 165 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -1 Query: 511 RDKIPEIEAVEQILDTETGLELNEENVEKVINLIFPFAS 395 RDKIPEIEAV+QILDTETGLELNE NVEKV++ I P+ S Sbjct: 74 RDKIPEIEAVQQILDTETGLELNEVNVEKVLSEIRPYLS 112 >ref|XP_006656418.1| PREDICTED: nifU-like protein 3, chloroplastic-like [Oryza brachyantha] Length = 209 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -1 Query: 511 RDKIPEIEAVEQILDTETGLELNEENVEKVINLIFPFAS 395 RDKIPEI AVEQI+DTETGLELN+ENVEKV++ I P+ S Sbjct: 118 RDKIPEILAVEQIVDTETGLELNQENVEKVLDEIRPYLS 156 >gb|EXB55373.1| NifU-like protein 3 [Morus notabilis] Length = 539 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -1 Query: 511 RDKIPEIEAVEQILDTETGLELNEENVEKVINLIFPF 401 RDKIPEI AVEQILDTETGLELNEENVEK++ I P+ Sbjct: 448 RDKIPEIMAVEQILDTETGLELNEENVEKLLAEIRPY 484 >ref|XP_002532084.1| Nitrogen fixation protein nifU, putative [Ricinus communis] gi|223528244|gb|EEF30298.1| Nitrogen fixation protein nifU, putative [Ricinus communis] Length = 220 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -1 Query: 511 RDKIPEIEAVEQILDTETGLELNEENVEKVINLIFPF 401 RDKIPEI AVEQILDTETGLELN+ENVEKV+ I P+ Sbjct: 129 RDKIPEIMAVEQILDTETGLELNDENVEKVLAEIRPY 165 >ref|XP_007014296.1| NFU domain protein 3 isoform 6 [Theobroma cacao] gi|508784659|gb|EOY31915.1| NFU domain protein 3 isoform 6 [Theobroma cacao] Length = 204 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -1 Query: 511 RDKIPEIEAVEQILDTETGLELNEENVEKVINLIFPF 401 RDKIPEI VEQI+DTETGLELNEENVEKV++ I P+ Sbjct: 113 RDKIPEILEVEQIMDTETGLELNEENVEKVLDEIRPY 149 >ref|XP_007014295.1| NFU domain protein 3 isoform 5 [Theobroma cacao] gi|508784658|gb|EOY31914.1| NFU domain protein 3 isoform 5 [Theobroma cacao] Length = 208 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -1 Query: 511 RDKIPEIEAVEQILDTETGLELNEENVEKVINLIFPF 401 RDKIPEI VEQI+DTETGLELNEENVEKV++ I P+ Sbjct: 117 RDKIPEILEVEQIMDTETGLELNEENVEKVLDEIRPY 153 >ref|XP_007014293.1| NFU domain protein 3 isoform 3, partial [Theobroma cacao] gi|508784656|gb|EOY31912.1| NFU domain protein 3 isoform 3, partial [Theobroma cacao] Length = 300 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -1 Query: 511 RDKIPEIEAVEQILDTETGLELNEENVEKVINLIFPF 401 RDKIPEI VEQI+DTETGLELNEENVEKV++ I P+ Sbjct: 209 RDKIPEILEVEQIMDTETGLELNEENVEKVLDEIRPY 245 >ref|XP_007014291.1| NFU domain protein 3 isoform 1 [Theobroma cacao] gi|508784654|gb|EOY31910.1| NFU domain protein 3 isoform 1 [Theobroma cacao] Length = 238 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -1 Query: 511 RDKIPEIEAVEQILDTETGLELNEENVEKVINLIFPF 401 RDKIPEI VEQI+DTETGLELNEENVEKV++ I P+ Sbjct: 147 RDKIPEILEVEQIMDTETGLELNEENVEKVLDEIRPY 183 >ref|XP_004148324.1| PREDICTED: nifU-like protein 3, chloroplastic-like [Cucumis sativus] gi|449510563|ref|XP_004163700.1| PREDICTED: nifU-like protein 3, chloroplastic-like [Cucumis sativus] Length = 227 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -1 Query: 511 RDKIPEIEAVEQILDTETGLELNEENVEKVINLIFPF 401 RDKIPEI VEQI+DTETGLELNEENVEKV++ I P+ Sbjct: 136 RDKIPEILEVEQIMDTETGLELNEENVEKVLSEIRPY 172 >ref|XP_006356915.1| PREDICTED: nifU-like protein 3, chloroplastic-like [Solanum tuberosum] Length = 232 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -1 Query: 511 RDKIPEIEAVEQILDTETGLELNEENVEKVINLIFPF 401 RDKIPEI AVEQILD+ETGLELNEEN+EK++ I P+ Sbjct: 141 RDKIPEIMAVEQILDSETGLELNEENIEKLLGEIRPY 177 >ref|XP_006845689.1| hypothetical protein AMTR_s00019p00236430 [Amborella trichopoda] gi|548848261|gb|ERN07364.1| hypothetical protein AMTR_s00019p00236430 [Amborella trichopoda] Length = 233 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -1 Query: 508 DKIPEIEAVEQILDTETGLELNEENVEKVINLIFPF 401 DKIPEI AVEQILDTETGLELN+ENVEKV++ I P+ Sbjct: 142 DKIPEILAVEQILDTETGLELNDENVEKVLSEIRPY 177 >ref|XP_004240148.1| PREDICTED: nifU-like protein 3, chloroplastic-like isoform 1 [Solanum lycopersicum] gi|460388996|ref|XP_004240149.1| PREDICTED: nifU-like protein 3, chloroplastic-like isoform 2 [Solanum lycopersicum] Length = 232 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -1 Query: 511 RDKIPEIEAVEQILDTETGLELNEENVEKVINLIFPF 401 RDKIPEI AVEQILD+ETGLELNEEN+EK++ I P+ Sbjct: 141 RDKIPEIMAVEQILDSETGLELNEENIEKLLGEIRPY 177 >ref|XP_006453321.1| hypothetical protein CICLE_v10009375mg [Citrus clementina] gi|568840517|ref|XP_006474213.1| PREDICTED: nifU-like protein 3, chloroplastic-like [Citrus sinensis] gi|557556547|gb|ESR66561.1| hypothetical protein CICLE_v10009375mg [Citrus clementina] Length = 231 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -1 Query: 511 RDKIPEIEAVEQILDTETGLELNEENVEKVINLIFPF 401 RDKIPEI VEQILDTETGLELNEEN+EKV+ I P+ Sbjct: 140 RDKIPEILEVEQILDTETGLELNEENIEKVLAEIRPY 176 >ref|XP_007223846.1| hypothetical protein PRUPE_ppa010743mg [Prunus persica] gi|462420782|gb|EMJ25045.1| hypothetical protein PRUPE_ppa010743mg [Prunus persica] Length = 238 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -1 Query: 511 RDKIPEIEAVEQILDTETGLELNEENVEKVINLIFPF 401 RDKIPEI VEQILD ETGLELNEENVEKV++ I P+ Sbjct: 147 RDKIPEIMEVEQILDRETGLELNEENVEKVLSEIRPY 183 >ref|NP_001058443.1| Os06g0694500 [Oryza sativa Japonica Group] gi|53791826|dbj|BAD53892.1| putative Nuclear-encoded plastid gene, NifU1 [Oryza sativa Japonica Group] gi|53792847|dbj|BAD53880.1| putative Nuclear-encoded plastid gene, NifU1 [Oryza sativa Japonica Group] gi|113596483|dbj|BAF20357.1| Os06g0694500 [Oryza sativa Japonica Group] gi|215678926|dbj|BAG96356.1| unnamed protein product [Oryza sativa Japonica Group] gi|215695250|dbj|BAG90441.1| unnamed protein product [Oryza sativa Japonica Group] gi|218198813|gb|EEC81240.1| hypothetical protein OsI_24300 [Oryza sativa Indica Group] gi|222636145|gb|EEE66277.1| hypothetical protein OsJ_22478 [Oryza sativa Japonica Group] Length = 219 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -1 Query: 511 RDKIPEIEAVEQILDTETGLELNEENVEKVINLIFPFAS 395 RDKIPEI AVEQI+DTETGLELN +NV+KV++ I P+ S Sbjct: 128 RDKIPEILAVEQIVDTETGLELNHDNVDKVLDEIRPYLS 166 >ref|XP_004296460.1| PREDICTED: nifU-like protein 3, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 235 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -1 Query: 511 RDKIPEIEAVEQILDTETGLELNEENVEKVINLIFPF 401 RDKIPEI VEQILDTETGL+LNEENVEK++ I P+ Sbjct: 144 RDKIPEIMEVEQILDTETGLDLNEENVEKLLAEIRPY 180 >ref|XP_007138803.1| hypothetical protein PHAVU_009G238700g [Phaseolus vulgaris] gi|561011890|gb|ESW10797.1| hypothetical protein PHAVU_009G238700g [Phaseolus vulgaris] Length = 236 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -1 Query: 511 RDKIPEIEAVEQILDTETGLELNEENVEKVINLIFPF 401 RDKIPEI VEQI+DTETGLEL EEN+EKV++ I P+ Sbjct: 145 RDKIPEILEVEQIMDTETGLELTEENIEKVLSEIRPY 181 >ref|XP_006381779.1| hypothetical protein POPTR_0006s17930g [Populus trichocarpa] gi|118487917|gb|ABK95780.1| unknown [Populus trichocarpa] gi|550336535|gb|ERP59576.1| hypothetical protein POPTR_0006s17930g [Populus trichocarpa] Length = 224 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -1 Query: 511 RDKIPEIEAVEQILDTETGLELNEENVEKVINLIFPF 401 RDKIPEI VEQI+DTETGLELNEENVEK + I P+ Sbjct: 133 RDKIPEIMDVEQIMDTETGLELNEENVEKALAEIRPY 169