BLASTX nr result
ID: Mentha23_contig00033715
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00033715 (425 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23218.1| hypothetical protein MIMGU_mgv1a007992mg [Mimulus... 116 3e-24 ref|XP_003542443.1| PREDICTED: endoplasmic reticulum-Golgi inter... 110 2e-22 ref|XP_007227487.1| hypothetical protein PRUPE_ppa007001mg [Prun... 109 3e-22 ref|XP_002285801.1| PREDICTED: endoplasmic reticulum-Golgi inter... 109 3e-22 ref|XP_004150658.1| PREDICTED: endoplasmic reticulum-Golgi inter... 109 4e-22 gb|EXC06716.1| hypothetical protein L484_021555 [Morus notabilis] 108 6e-22 ref|XP_003544786.1| PREDICTED: endoplasmic reticulum-Golgi inter... 108 6e-22 ref|XP_002306582.1| hypothetical protein POPTR_0005s16700g [Popu... 108 8e-22 ref|XP_006354000.1| PREDICTED: endoplasmic reticulum-Golgi inter... 108 1e-21 ref|XP_004237893.1| PREDICTED: endoplasmic reticulum-Golgi inter... 108 1e-21 ref|XP_002513896.1| Endoplasmic reticulum-Golgi intermediate com... 107 1e-21 ref|XP_004514266.1| PREDICTED: endoplasmic reticulum-Golgi inter... 107 2e-21 ref|NP_001052965.2| Os04g0455900 [Oryza sativa Japonica Group] g... 107 2e-21 emb|CAE02574.2| OSJNBa0006M15.17 [Oryza sativa Japonica Group] g... 107 2e-21 ref|XP_006652356.1| PREDICTED: endoplasmic reticulum-Golgi inter... 106 4e-21 ref|XP_002302286.1| hypothetical protein POPTR_0002s09500g [Popu... 106 4e-21 ref|XP_002447951.1| hypothetical protein SORBIDRAFT_06g018670 [S... 105 5e-21 ref|XP_007141162.1| hypothetical protein PHAVU_008G172300g [Phas... 105 8e-21 ref|XP_004975824.1| PREDICTED: endoplasmic reticulum-Golgi inter... 104 1e-20 ref|XP_003615024.1| Endoplasmic reticulum-Golgi intermediate com... 103 2e-20 >gb|EYU23218.1| hypothetical protein MIMGU_mgv1a007992mg [Mimulus guttatus] Length = 388 Score = 116 bits (291), Expect = 3e-24 Identities = 59/63 (93%), Positives = 63/63 (100%) Frame = -2 Query: 190 IMESLIGKLRSLDAYPKINEDFYSRTLSGGVITLASTIVMLLLFISELRLYLHAVTETKL 11 +MES+IGKLRSLDAYPKINEDFYSRTLSGGVITLAS+IVMLLLFISELRLYLH+VTETKL Sbjct: 2 MMESIIGKLRSLDAYPKINEDFYSRTLSGGVITLASSIVMLLLFISELRLYLHSVTETKL 61 Query: 10 VVD 2 VVD Sbjct: 62 VVD 64 >ref|XP_003542443.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Glycine max] Length = 386 Score = 110 bits (276), Expect = 2e-22 Identities = 56/62 (90%), Positives = 60/62 (96%) Frame = -2 Query: 187 MESLIGKLRSLDAYPKINEDFYSRTLSGGVITLASTIVMLLLFISELRLYLHAVTETKLV 8 MES+I KLR+LDAYPKINEDFYSRTLSGGVITLAS+I+MLLLF SELRLYLHAVTETKLV Sbjct: 1 MESIISKLRNLDAYPKINEDFYSRTLSGGVITLASSILMLLLFYSELRLYLHAVTETKLV 60 Query: 7 VD 2 VD Sbjct: 61 VD 62 >ref|XP_007227487.1| hypothetical protein PRUPE_ppa007001mg [Prunus persica] gi|462424423|gb|EMJ28686.1| hypothetical protein PRUPE_ppa007001mg [Prunus persica] Length = 386 Score = 109 bits (273), Expect = 3e-22 Identities = 54/62 (87%), Positives = 61/62 (98%) Frame = -2 Query: 187 MESLIGKLRSLDAYPKINEDFYSRTLSGGVITLASTIVMLLLFISELRLYLHAVTETKLV 8 ME+++ +LR+LDAYPKINEDFYSRTLSGGVITLAS+IVMLLLF+SELRLYLHAVTETKLV Sbjct: 1 MENMMSRLRNLDAYPKINEDFYSRTLSGGVITLASSIVMLLLFLSELRLYLHAVTETKLV 60 Query: 7 VD 2 VD Sbjct: 61 VD 62 >ref|XP_002285801.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3 [Vitis vinifera] gi|302141938|emb|CBI19141.3| unnamed protein product [Vitis vinifera] Length = 386 Score = 109 bits (273), Expect = 3e-22 Identities = 55/62 (88%), Positives = 60/62 (96%) Frame = -2 Query: 187 MESLIGKLRSLDAYPKINEDFYSRTLSGGVITLASTIVMLLLFISELRLYLHAVTETKLV 8 M+++I KLR+LDAYPKINEDFYSRTLSGGVITLAS+I MLLLFISELRLYLHAVTETKLV Sbjct: 1 MDNIINKLRNLDAYPKINEDFYSRTLSGGVITLASSIFMLLLFISELRLYLHAVTETKLV 60 Query: 7 VD 2 VD Sbjct: 61 VD 62 >ref|XP_004150658.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Cucumis sativus] gi|449518819|ref|XP_004166433.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Cucumis sativus] Length = 386 Score = 109 bits (272), Expect = 4e-22 Identities = 54/62 (87%), Positives = 61/62 (98%) Frame = -2 Query: 187 MESLIGKLRSLDAYPKINEDFYSRTLSGGVITLASTIVMLLLFISELRLYLHAVTETKLV 8 M+++I KLR+LDAYPKINEDFYSRTLSGGVITL+S+I+MLLLFISELRLYLHAVTETKLV Sbjct: 1 MDNIISKLRNLDAYPKINEDFYSRTLSGGVITLSSSILMLLLFISELRLYLHAVTETKLV 60 Query: 7 VD 2 VD Sbjct: 61 VD 62 >gb|EXC06716.1| hypothetical protein L484_021555 [Morus notabilis] Length = 386 Score = 108 bits (271), Expect = 6e-22 Identities = 54/62 (87%), Positives = 61/62 (98%) Frame = -2 Query: 187 MESLIGKLRSLDAYPKINEDFYSRTLSGGVITLASTIVMLLLFISELRLYLHAVTETKLV 8 ME+++ KLR+LDAYPKINEDFYSRTLSGGVITLAS+IVMLLLF+SELRLYLHAVTET+LV Sbjct: 1 MENVMSKLRNLDAYPKINEDFYSRTLSGGVITLASSIVMLLLFLSELRLYLHAVTETQLV 60 Query: 7 VD 2 VD Sbjct: 61 VD 62 >ref|XP_003544786.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Glycine max] Length = 386 Score = 108 bits (271), Expect = 6e-22 Identities = 54/62 (87%), Positives = 60/62 (96%) Frame = -2 Query: 187 MESLIGKLRSLDAYPKINEDFYSRTLSGGVITLASTIVMLLLFISELRLYLHAVTETKLV 8 M+S++ KLR+LDAYPKINEDFYSRTLSGGVITLAS+I+MLLLF SELRLYLHAVTETKLV Sbjct: 1 MDSIMSKLRNLDAYPKINEDFYSRTLSGGVITLASSILMLLLFFSELRLYLHAVTETKLV 60 Query: 7 VD 2 VD Sbjct: 61 VD 62 >ref|XP_002306582.1| hypothetical protein POPTR_0005s16700g [Populus trichocarpa] gi|222856031|gb|EEE93578.1| hypothetical protein POPTR_0005s16700g [Populus trichocarpa] Length = 386 Score = 108 bits (270), Expect = 8e-22 Identities = 54/62 (87%), Positives = 58/62 (93%) Frame = -2 Query: 187 MESLIGKLRSLDAYPKINEDFYSRTLSGGVITLASTIVMLLLFISELRLYLHAVTETKLV 8 ME L+ KLR+LDAYPKINEDFYSRTLSGGVITLAS++VM LLF SELRLYLHAVTETKLV Sbjct: 1 MEGLMSKLRNLDAYPKINEDFYSRTLSGGVITLASSVVMFLLFFSELRLYLHAVTETKLV 60 Query: 7 VD 2 VD Sbjct: 61 VD 62 >ref|XP_006354000.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Solanum tuberosum] Length = 386 Score = 108 bits (269), Expect = 1e-21 Identities = 53/62 (85%), Positives = 58/62 (93%) Frame = -2 Query: 187 MESLIGKLRSLDAYPKINEDFYSRTLSGGVITLASTIVMLLLFISELRLYLHAVTETKLV 8 M+S I K+RSLDAYPKINEDFYSRTLSGGVITLAS+I+M LLFISELRLYLHA TETKL+ Sbjct: 1 MDSFISKIRSLDAYPKINEDFYSRTLSGGVITLASSIIMTLLFISELRLYLHAATETKLI 60 Query: 7 VD 2 VD Sbjct: 61 VD 62 >ref|XP_004237893.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Solanum lycopersicum] Length = 386 Score = 108 bits (269), Expect = 1e-21 Identities = 53/62 (85%), Positives = 58/62 (93%) Frame = -2 Query: 187 MESLIGKLRSLDAYPKINEDFYSRTLSGGVITLASTIVMLLLFISELRLYLHAVTETKLV 8 M+S + K+RSLDAYPKINEDFYSRTLSGGVITLAS+I+M LLFISELRLYLHA TETKLV Sbjct: 1 MDSFVSKIRSLDAYPKINEDFYSRTLSGGVITLASSIIMTLLFISELRLYLHAATETKLV 60 Query: 7 VD 2 VD Sbjct: 61 VD 62 >ref|XP_002513896.1| Endoplasmic reticulum-Golgi intermediate compartment protein, putative [Ricinus communis] gi|223546982|gb|EEF48479.1| Endoplasmic reticulum-Golgi intermediate compartment protein, putative [Ricinus communis] Length = 386 Score = 107 bits (268), Expect = 1e-21 Identities = 53/62 (85%), Positives = 59/62 (95%) Frame = -2 Query: 187 MESLIGKLRSLDAYPKINEDFYSRTLSGGVITLASTIVMLLLFISELRLYLHAVTETKLV 8 ME ++ KLR+LDAYPKINEDFYSRTLSGGVITLAS+I+MLLLFISELRLY+HAVTETKL Sbjct: 1 MEGIMNKLRNLDAYPKINEDFYSRTLSGGVITLASSILMLLLFISELRLYIHAVTETKLA 60 Query: 7 VD 2 VD Sbjct: 61 VD 62 >ref|XP_004514266.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Cicer arietinum] Length = 386 Score = 107 bits (266), Expect = 2e-21 Identities = 52/62 (83%), Positives = 59/62 (95%) Frame = -2 Query: 187 MESLIGKLRSLDAYPKINEDFYSRTLSGGVITLASTIVMLLLFISELRLYLHAVTETKLV 8 M+S++ KLR+LDAYPKINEDFYSRTLSGGVITLAS+I+MLLLF SELRLYLHA TETKL+ Sbjct: 1 MDSIMSKLRNLDAYPKINEDFYSRTLSGGVITLASSILMLLLFFSELRLYLHAATETKLI 60 Query: 7 VD 2 VD Sbjct: 61 VD 62 >ref|NP_001052965.2| Os04g0455900 [Oryza sativa Japonica Group] gi|255675519|dbj|BAF14879.2| Os04g0455900 [Oryza sativa Japonica Group] Length = 253 Score = 107 bits (266), Expect = 2e-21 Identities = 52/62 (83%), Positives = 58/62 (93%) Frame = -2 Query: 187 MESLIGKLRSLDAYPKINEDFYSRTLSGGVITLASTIVMLLLFISELRLYLHAVTETKLV 8 ME L+ KLRSLDAYPK+NEDFYSRTLSGG+ITLAS++VMLLLF+SELRLYLHAVTET L Sbjct: 1 MEGLLSKLRSLDAYPKVNEDFYSRTLSGGIITLASSVVMLLLFVSELRLYLHAVTETTLR 60 Query: 7 VD 2 VD Sbjct: 61 VD 62 >emb|CAE02574.2| OSJNBa0006M15.17 [Oryza sativa Japonica Group] gi|116309990|emb|CAH67017.1| H0523F07.5 [Oryza sativa Indica Group] gi|218194960|gb|EEC77387.1| hypothetical protein OsI_16129 [Oryza sativa Indica Group] Length = 386 Score = 107 bits (266), Expect = 2e-21 Identities = 52/62 (83%), Positives = 58/62 (93%) Frame = -2 Query: 187 MESLIGKLRSLDAYPKINEDFYSRTLSGGVITLASTIVMLLLFISELRLYLHAVTETKLV 8 ME L+ KLRSLDAYPK+NEDFYSRTLSGG+ITLAS++VMLLLF+SELRLYLHAVTET L Sbjct: 1 MEGLLSKLRSLDAYPKVNEDFYSRTLSGGIITLASSVVMLLLFVSELRLYLHAVTETTLR 60 Query: 7 VD 2 VD Sbjct: 61 VD 62 >ref|XP_006652356.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Oryza brachyantha] Length = 386 Score = 106 bits (264), Expect = 4e-21 Identities = 52/62 (83%), Positives = 58/62 (93%) Frame = -2 Query: 187 MESLIGKLRSLDAYPKINEDFYSRTLSGGVITLASTIVMLLLFISELRLYLHAVTETKLV 8 ME L+ KLRSLDAYPK+NEDFYSRTLSGG+ITLAS++VMLLLF+SELRLYLHAVTET L Sbjct: 1 MEGLLTKLRSLDAYPKVNEDFYSRTLSGGIITLASSVVMLLLFVSELRLYLHAVTETTLR 60 Query: 7 VD 2 VD Sbjct: 61 VD 62 >ref|XP_002302286.1| hypothetical protein POPTR_0002s09500g [Populus trichocarpa] gi|222844012|gb|EEE81559.1| hypothetical protein POPTR_0002s09500g [Populus trichocarpa] Length = 377 Score = 106 bits (264), Expect = 4e-21 Identities = 53/62 (85%), Positives = 57/62 (91%) Frame = -2 Query: 187 MESLIGKLRSLDAYPKINEDFYSRTLSGGVITLASTIVMLLLFISELRLYLHAVTETKLV 8 M+ L+ KLR+ DAYPKINEDFYSRTLSGGVITLAS+IVM LLF SELRLYLHAVTETKLV Sbjct: 1 MDGLMSKLRNFDAYPKINEDFYSRTLSGGVITLASSIVMFLLFFSELRLYLHAVTETKLV 60 Query: 7 VD 2 VD Sbjct: 61 VD 62 >ref|XP_002447951.1| hypothetical protein SORBIDRAFT_06g018670 [Sorghum bicolor] gi|241939134|gb|EES12279.1| hypothetical protein SORBIDRAFT_06g018670 [Sorghum bicolor] Length = 386 Score = 105 bits (263), Expect = 5e-21 Identities = 51/62 (82%), Positives = 58/62 (93%) Frame = -2 Query: 187 MESLIGKLRSLDAYPKINEDFYSRTLSGGVITLASTIVMLLLFISELRLYLHAVTETKLV 8 M+ L+ KLRSLDAYPK+NEDFYSRTLSGGVITLAS+++MLLLF+SELRLYLHAVTET L Sbjct: 1 MDGLLSKLRSLDAYPKVNEDFYSRTLSGGVITLASSVIMLLLFVSELRLYLHAVTETTLR 60 Query: 7 VD 2 VD Sbjct: 61 VD 62 >ref|XP_007141162.1| hypothetical protein PHAVU_008G172300g [Phaseolus vulgaris] gi|561014295|gb|ESW13156.1| hypothetical protein PHAVU_008G172300g [Phaseolus vulgaris] Length = 386 Score = 105 bits (261), Expect = 8e-21 Identities = 52/62 (83%), Positives = 58/62 (93%) Frame = -2 Query: 187 MESLIGKLRSLDAYPKINEDFYSRTLSGGVITLASTIVMLLLFISELRLYLHAVTETKLV 8 ME ++ KLR+LDAYPKINEDFYSRTLSGGVITLAS+I+MLLLF SELRLYL +VTETKLV Sbjct: 1 MEGIMSKLRNLDAYPKINEDFYSRTLSGGVITLASSIIMLLLFFSELRLYLQSVTETKLV 60 Query: 7 VD 2 VD Sbjct: 61 VD 62 >ref|XP_004975824.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Setaria italica] Length = 386 Score = 104 bits (260), Expect = 1e-20 Identities = 50/62 (80%), Positives = 58/62 (93%) Frame = -2 Query: 187 MESLIGKLRSLDAYPKINEDFYSRTLSGGVITLASTIVMLLLFISELRLYLHAVTETKLV 8 M+ L+ KLR+LDAYPK+NEDFYSRTLSGG+ITLAS++VMLLLF+SELRLYLHAVTET L Sbjct: 1 MDGLLSKLRNLDAYPKVNEDFYSRTLSGGIITLASSVVMLLLFVSELRLYLHAVTETTLR 60 Query: 7 VD 2 VD Sbjct: 61 VD 62 >ref|XP_003615024.1| Endoplasmic reticulum-Golgi intermediate compartment protein [Medicago truncatula] gi|355516359|gb|AES97982.1| Endoplasmic reticulum-Golgi intermediate compartment protein [Medicago truncatula] Length = 386 Score = 103 bits (258), Expect = 2e-20 Identities = 50/62 (80%), Positives = 58/62 (93%) Frame = -2 Query: 187 MESLIGKLRSLDAYPKINEDFYSRTLSGGVITLASTIVMLLLFISELRLYLHAVTETKLV 8 M+S++ KLR+LDAYPKINEDFYSRTLSGG+IT+ S+I+MLLLF SELRLYLHA TETKLV Sbjct: 1 MDSIMNKLRNLDAYPKINEDFYSRTLSGGLITIVSSILMLLLFFSELRLYLHAATETKLV 60 Query: 7 VD 2 VD Sbjct: 61 VD 62