BLASTX nr result
ID: Mentha23_contig00033678
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00033678 (582 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281697.1| PREDICTED: eukaryotic translation initiation... 72 8e-11 gb|EXB68024.1| Eukaryotic translation initiation factor 4E type ... 72 1e-10 ref|XP_004288413.1| PREDICTED: eukaryotic translation initiation... 71 2e-10 ref|XP_003518260.1| PREDICTED: eukaryotic translation initiation... 71 2e-10 ref|XP_007151853.1| hypothetical protein PHAVU_004G080900g [Phas... 71 2e-10 gb|ACU15859.1| unknown [Glycine max] 71 2e-10 ref|NP_001235427.1| uncharacterized protein LOC100499744 [Glycin... 71 2e-10 ref|XP_002525418.1| eukaryotic translation initiation factor 4e ... 71 2e-10 ref|XP_006858937.1| hypothetical protein AMTR_s00068p00082940 [A... 70 3e-10 ref|XP_006479329.1| PREDICTED: eukaryotic translation initiation... 70 4e-10 ref|XP_006443436.1| hypothetical protein CICLE_v10022151mg [Citr... 70 4e-10 ref|XP_007030090.1| Cap-binding protein isoform 2 [Theobroma cac... 70 4e-10 ref|XP_007030089.1| Cap-binding protein isoform 1 [Theobroma cac... 70 4e-10 ref|XP_006351360.1| PREDICTED: eukaryotic translation initiation... 70 5e-10 ref|XP_004249299.1| PREDICTED: eukaryotic translation initiation... 70 5e-10 ref|XP_001752874.1| predicted protein [Physcomitrella patens] gi... 70 5e-10 ref|XP_004163619.1| PREDICTED: eukaryotic translation initiation... 69 7e-10 ref|XP_004141135.1| PREDICTED: eukaryotic translation initiation... 69 7e-10 ref|XP_006574760.1| PREDICTED: eukaryotic translation initiation... 69 1e-09 gb|EPS68535.1| cap-binding protein-like protein [Genlisea aurea] 69 1e-09 >ref|XP_002281697.1| PREDICTED: eukaryotic translation initiation factor 4E type 3 [Vitis vinifera] gi|297739767|emb|CBI29949.3| unnamed protein product [Vitis vinifera] Length = 225 Score = 72.4 bits (176), Expect = 8e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +2 Query: 470 IHDVQHKFVFWYTRRTPGVRSQTSYEDNIKHIVDFST 580 +H ++HKFVFWYTRRTPGVR+QTSYEDNIK IVDFST Sbjct: 45 LHPLKHKFVFWYTRRTPGVRTQTSYEDNIKKIVDFST 81 >gb|EXB68024.1| Eukaryotic translation initiation factor 4E type 3 [Morus notabilis] Length = 230 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 470 IHDVQHKFVFWYTRRTPGVRSQTSYEDNIKHIVDFST 580 +H ++HKFVFWYTRRTPGVRSQ SYEDNIK IVDFST Sbjct: 50 LHPLKHKFVFWYTRRTPGVRSQASYEDNIKKIVDFST 86 >ref|XP_004288413.1| PREDICTED: eukaryotic translation initiation factor NCBP-like [Fragaria vesca subsp. vesca] Length = 219 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +2 Query: 470 IHDVQHKFVFWYTRRTPGVRSQTSYEDNIKHIVDFST 580 +H +++KFVFWYTRRTPGVRSQTSYEDNIK IVDFST Sbjct: 39 LHPLKNKFVFWYTRRTPGVRSQTSYEDNIKKIVDFST 75 >ref|XP_003518260.1| PREDICTED: eukaryotic translation initiation factor NCBP-like isoform X1 [Glycine max] Length = 231 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +2 Query: 470 IHDVQHKFVFWYTRRTPGVRSQTSYEDNIKHIVDFST 580 +H ++HKFVFWYTRRTPGVR+QTSYEDNIK IV+FST Sbjct: 51 LHPLKHKFVFWYTRRTPGVRNQTSYEDNIKKIVEFST 87 >ref|XP_007151853.1| hypothetical protein PHAVU_004G080900g [Phaseolus vulgaris] gi|156153162|gb|ABU54819.1| cap-binding protein-like protein [Phaseolus vulgaris] gi|156153164|gb|ABU54820.1| cap-binding protein-like protein [Phaseolus vulgaris] gi|156153166|gb|ABU54821.1| cap-binding protein-like protein [Phaseolus vulgaris] gi|156153168|gb|ABU54822.1| cap-binding protein-like protein [Phaseolus vulgaris] gi|156153170|gb|ABU54823.1| cap-binding protein-like protein [Phaseolus vulgaris] gi|156153172|gb|ABU54824.1| cap-binding protein-like protein [Phaseolus vulgaris] gi|156153174|gb|ABU54825.1| cap-binding protein-like protein [Phaseolus vulgaris] gi|561025162|gb|ESW23847.1| hypothetical protein PHAVU_004G080900g [Phaseolus vulgaris] Length = 233 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +2 Query: 470 IHDVQHKFVFWYTRRTPGVRSQTSYEDNIKHIVDFST 580 +H ++HKFVFWYTRRTPGVR+QTSYEDNIK IV+FST Sbjct: 53 LHPLKHKFVFWYTRRTPGVRNQTSYEDNIKKIVEFST 89 >gb|ACU15859.1| unknown [Glycine max] Length = 231 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +2 Query: 470 IHDVQHKFVFWYTRRTPGVRSQTSYEDNIKHIVDFST 580 +H ++HKFVFWYTRRTPGVR+QTSYEDNIK IV+FST Sbjct: 51 LHPLKHKFVFWYTRRTPGVRNQTSYEDNIKKIVEFST 87 >ref|NP_001235427.1| uncharacterized protein LOC100499744 [Glycine max] gi|255626233|gb|ACU13461.1| unknown [Glycine max] Length = 231 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +2 Query: 470 IHDVQHKFVFWYTRRTPGVRSQTSYEDNIKHIVDFST 580 +H ++HKFVFWYTRRTPGVR+QTSYEDNIK IV+FST Sbjct: 51 LHPLKHKFVFWYTRRTPGVRNQTSYEDNIKKIVEFST 87 >ref|XP_002525418.1| eukaryotic translation initiation factor 4e type, putative [Ricinus communis] gi|223535231|gb|EEF36908.1| eukaryotic translation initiation factor 4e type, putative [Ricinus communis] Length = 222 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +2 Query: 470 IHDVQHKFVFWYTRRTPGVRSQTSYEDNIKHIVDFST 580 +H ++HKFVFWYTRRTPGVR+QTSYEDNIK IV+FST Sbjct: 42 LHPLKHKFVFWYTRRTPGVRTQTSYEDNIKKIVEFST 78 >ref|XP_006858937.1| hypothetical protein AMTR_s00068p00082940 [Amborella trichopoda] gi|548863049|gb|ERN20404.1| hypothetical protein AMTR_s00068p00082940 [Amborella trichopoda] Length = 228 Score = 70.5 bits (171), Expect = 3e-10 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 470 IHDVQHKFVFWYTRRTPGVRSQTSYEDNIKHIVDFST 580 +H +Q KFVFWYTRRTPGVRSQTSYEDNIK IV+FST Sbjct: 48 LHPLQQKFVFWYTRRTPGVRSQTSYEDNIKKIVEFST 84 >ref|XP_006479329.1| PREDICTED: eukaryotic translation initiation factor NCBP-like [Citrus sinensis] Length = 225 Score = 70.1 bits (170), Expect = 4e-10 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = +2 Query: 467 HIHDVQHKFVFWYTRRTPGVRSQTSYEDNIKHIVDFST 580 ++H +++KFVFWYTRRTPGVR+QTSYEDNIK IVDFST Sbjct: 39 NLHPLKNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFST 76 >ref|XP_006443436.1| hypothetical protein CICLE_v10022151mg [Citrus clementina] gi|557545698|gb|ESR56676.1| hypothetical protein CICLE_v10022151mg [Citrus clementina] Length = 220 Score = 70.1 bits (170), Expect = 4e-10 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = +2 Query: 467 HIHDVQHKFVFWYTRRTPGVRSQTSYEDNIKHIVDFST 580 ++H +++KFVFWYTRRTPGVR+QTSYEDNIK IVDFST Sbjct: 39 NLHPLKNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFST 76 >ref|XP_007030090.1| Cap-binding protein isoform 2 [Theobroma cacao] gi|508718695|gb|EOY10592.1| Cap-binding protein isoform 2 [Theobroma cacao] Length = 278 Score = 70.1 bits (170), Expect = 4e-10 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = +2 Query: 470 IHDVQHKFVFWYTRRTPGVRSQTSYEDNIKHIVDFST 580 +H ++HK+VFWYTRRTPGVR+QT+YEDNIK IVDFST Sbjct: 52 LHPLKHKYVFWYTRRTPGVRTQTAYEDNIKKIVDFST 88 >ref|XP_007030089.1| Cap-binding protein isoform 1 [Theobroma cacao] gi|508718694|gb|EOY10591.1| Cap-binding protein isoform 1 [Theobroma cacao] Length = 232 Score = 70.1 bits (170), Expect = 4e-10 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = +2 Query: 470 IHDVQHKFVFWYTRRTPGVRSQTSYEDNIKHIVDFST 580 +H ++HK+VFWYTRRTPGVR+QT+YEDNIK IVDFST Sbjct: 52 LHPLKHKYVFWYTRRTPGVRTQTAYEDNIKKIVDFST 88 >ref|XP_006351360.1| PREDICTED: eukaryotic translation initiation factor NCBP-like [Solanum tuberosum] Length = 223 Score = 69.7 bits (169), Expect = 5e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +2 Query: 470 IHDVQHKFVFWYTRRTPGVRSQTSYEDNIKHIVDFST 580 +H +++KFVFWYTRRTPGVR+QTSYEDNIK IVDFST Sbjct: 43 LHPLKNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFST 79 >ref|XP_004249299.1| PREDICTED: eukaryotic translation initiation factor NCBP-like [Solanum lycopersicum] Length = 223 Score = 69.7 bits (169), Expect = 5e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +2 Query: 470 IHDVQHKFVFWYTRRTPGVRSQTSYEDNIKHIVDFST 580 +H +++KFVFWYTRRTPGVR+QTSYEDNIK IVDFST Sbjct: 43 LHPLKNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFST 79 >ref|XP_001752874.1| predicted protein [Physcomitrella patens] gi|162696037|gb|EDQ82378.1| predicted protein [Physcomitrella patens] Length = 286 Score = 69.7 bits (169), Expect = 5e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +2 Query: 470 IHDVQHKFVFWYTRRTPGVRSQTSYEDNIKHIVDFST 580 +H +QH+FVFWYTRR PG+RSQTSYEDNIK I DFST Sbjct: 106 LHPLQHRFVFWYTRRQPGIRSQTSYEDNIKKIADFST 142 >ref|XP_004163619.1| PREDICTED: eukaryotic translation initiation factor 4E type 3-like, partial [Cucumis sativus] Length = 155 Score = 69.3 bits (168), Expect = 7e-10 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +2 Query: 470 IHDVQHKFVFWYTRRTPGVRSQTSYEDNIKHIVDFST 580 +H ++HKF FWYTRRTPGVR+QTSYEDNIK IVDFS+ Sbjct: 58 LHPLKHKFAFWYTRRTPGVRTQTSYEDNIKKIVDFSS 94 >ref|XP_004141135.1| PREDICTED: eukaryotic translation initiation factor 4E type 3-like [Cucumis sativus] Length = 238 Score = 69.3 bits (168), Expect = 7e-10 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +2 Query: 470 IHDVQHKFVFWYTRRTPGVRSQTSYEDNIKHIVDFST 580 +H ++HKF FWYTRRTPGVR+QTSYEDNIK IVDFS+ Sbjct: 58 LHPLKHKFAFWYTRRTPGVRTQTSYEDNIKKIVDFSS 94 >ref|XP_006574760.1| PREDICTED: eukaryotic translation initiation factor NCBP-like isoform X2 [Glycine max] Length = 232 Score = 68.6 bits (166), Expect = 1e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 482 QHKFVFWYTRRTPGVRSQTSYEDNIKHIVDFST 580 QHKFVFWYTRRTPGVR+QTSYEDNIK IV+FST Sbjct: 56 QHKFVFWYTRRTPGVRNQTSYEDNIKKIVEFST 88 >gb|EPS68535.1| cap-binding protein-like protein [Genlisea aurea] Length = 238 Score = 68.6 bits (166), Expect = 1e-09 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = +2 Query: 470 IHDVQHKFVFWYTRRTPGVRSQTSYEDNIKHIVDFST 580 +H +++KFVFWYTRRTPGVR+QTSYEDNIK IV+FST Sbjct: 58 LHPLKYKFVFWYTRRTPGVRTQTSYEDNIKKIVEFST 94