BLASTX nr result
ID: Mentha23_contig00033642
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00033642 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21751.1| hypothetical protein MIMGU_mgv1a001232mg [Mimulus... 56 5e-06 >gb|EYU21751.1| hypothetical protein MIMGU_mgv1a001232mg [Mimulus guttatus] Length = 859 Score = 56.2 bits (134), Expect = 5e-06 Identities = 32/55 (58%), Positives = 36/55 (65%) Frame = +3 Query: 174 LPLEIWRMPQLRHLFFHASYMLPQPLEGINYLPLENLQTLGLVRDLVWNEKIIRM 338 LP EIWRMPQLRHL + LP P EG L LENLQTL +V + V +EKI M Sbjct: 610 LPREIWRMPQLRHLVCRSFGPLPCPDEGAT-LALENLQTLAVVTNFVCSEKITEM 663