BLASTX nr result
ID: Mentha23_contig00032978
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00032978 (437 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007217155.1| hypothetical protein PRUPE_ppa001737mg [Prun... 72 6e-11 ref|XP_006585667.1| PREDICTED: exocyst complex component EXO84B-... 72 8e-11 ref|XP_006582989.1| PREDICTED: exocyst complex component EXO84B-... 72 8e-11 ref|XP_004507530.1| PREDICTED: uncharacterized protein LOC101505... 72 8e-11 ref|XP_006585666.1| PREDICTED: exocyst complex component EXO84B-... 72 8e-11 ref|XP_003529713.1| PREDICTED: exocyst complex component EXO84B-... 72 8e-11 gb|EXC28850.1| hypothetical protein L484_004980 [Morus notabilis] 72 1e-10 gb|EYU21227.1| hypothetical protein MIMGU_mgv1a001664mg [Mimulus... 71 1e-10 ref|XP_006492014.1| PREDICTED: exocyst complex component EXO84B-... 70 2e-10 ref|XP_006427730.1| hypothetical protein CICLE_v10024953mg [Citr... 70 2e-10 ref|XP_003604146.1| hypothetical protein MTR_4g005930 [Medicago ... 70 4e-10 ref|XP_004164949.1| PREDICTED: uncharacterized LOC101213590 [Cuc... 68 1e-09 ref|XP_004141739.1| PREDICTED: uncharacterized protein LOC101213... 68 1e-09 ref|XP_007142142.1| hypothetical protein PHAVU_008G256000g [Phas... 67 2e-09 ref|XP_002525003.1| conserved hypothetical protein [Ricinus comm... 67 3e-09 ref|XP_006378852.1| hypothetical protein POPTR_0010s25630g [Popu... 67 3e-09 ref|XP_002315387.1| hypothetical protein POPTR_0010s25630g [Popu... 67 3e-09 ref|XP_004303841.1| PREDICTED: exocyst complex component 8-like ... 65 8e-09 ref|XP_006342868.1| PREDICTED: uncharacterized protein LOC102578... 64 2e-08 ref|XP_004235510.1| PREDICTED: uncharacterized protein LOC101266... 64 2e-08 >ref|XP_007217155.1| hypothetical protein PRUPE_ppa001737mg [Prunus persica] gi|462413305|gb|EMJ18354.1| hypothetical protein PRUPE_ppa001737mg [Prunus persica] Length = 772 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +2 Query: 2 DDWFNEICQDAIDRLSGQPKNVNGERDLNSPTASLSAQ 115 DDWFNE+CQDAI+RLSG+PK NG+RDLNSPTAS+SAQ Sbjct: 724 DDWFNEVCQDAIERLSGRPKAANGDRDLNSPTASVSAQ 761 >ref|XP_006585667.1| PREDICTED: exocyst complex component EXO84B-like isoform X2 [Glycine max] Length = 641 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = +2 Query: 2 DDWFNEICQDAIDRLSGQPKNVNGERDLNSPTASLSAQ 115 D+WFN+ICQDA++RLSG+PK +NGERDLNSPTAS+SAQ Sbjct: 593 DEWFNDICQDAMERLSGKPKEINGERDLNSPTASVSAQ 630 >ref|XP_006582989.1| PREDICTED: exocyst complex component EXO84B-like isoform X2 [Glycine max] Length = 642 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = +2 Query: 2 DDWFNEICQDAIDRLSGQPKNVNGERDLNSPTASLSAQ 115 D+WFN+ICQDA++RLSG+PK +NGERDLNSPTAS+SAQ Sbjct: 594 DEWFNDICQDAMERLSGKPKEINGERDLNSPTASVSAQ 631 >ref|XP_004507530.1| PREDICTED: uncharacterized protein LOC101505374 [Cicer arietinum] Length = 762 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = +2 Query: 2 DDWFNEICQDAIDRLSGQPKNVNGERDLNSPTASLSAQ 115 D+WFNEICQDA++RLSG+PK +NGE+DLNSPTAS+SAQ Sbjct: 714 DEWFNEICQDAMERLSGRPKEINGEKDLNSPTASVSAQ 751 >ref|XP_006585666.1| PREDICTED: exocyst complex component EXO84B-like isoform X1 [Glycine max] Length = 768 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = +2 Query: 2 DDWFNEICQDAIDRLSGQPKNVNGERDLNSPTASLSAQ 115 D+WFN+ICQDA++RLSG+PK +NGERDLNSPTAS+SAQ Sbjct: 720 DEWFNDICQDAMERLSGKPKEINGERDLNSPTASVSAQ 757 >ref|XP_003529713.1| PREDICTED: exocyst complex component EXO84B-like isoform X1 [Glycine max] Length = 769 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = +2 Query: 2 DDWFNEICQDAIDRLSGQPKNVNGERDLNSPTASLSAQ 115 D+WFN+ICQDA++RLSG+PK +NGERDLNSPTAS+SAQ Sbjct: 721 DEWFNDICQDAMERLSGKPKEINGERDLNSPTASVSAQ 758 >gb|EXC28850.1| hypothetical protein L484_004980 [Morus notabilis] Length = 736 Score = 71.6 bits (174), Expect = 1e-10 Identities = 29/38 (76%), Positives = 37/38 (97%) Frame = +2 Query: 2 DDWFNEICQDAIDRLSGQPKNVNGERDLNSPTASLSAQ 115 DDWFN++CQ+AI+RLSG+PK +NGER+LNSPTAS+SAQ Sbjct: 688 DDWFNDVCQEAIERLSGKPKGINGERELNSPTASISAQ 725 >gb|EYU21227.1| hypothetical protein MIMGU_mgv1a001664mg [Mimulus guttatus] Length = 777 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +2 Query: 2 DDWFNEICQDAIDRLSGQPKNVNGERDLNSPTASLSAQ 115 DDWFNEICQDAI+RLSG+PK NGERD NSPTAS+SAQ Sbjct: 729 DDWFNEICQDAIERLSGKPKMTNGERDPNSPTASVSAQ 766 >ref|XP_006492014.1| PREDICTED: exocyst complex component EXO84B-like [Citrus sinensis] Length = 759 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = +2 Query: 2 DDWFNEICQDAIDRLSGQPKNVNGERDLNSPTASLSAQ 115 DDWFN+ICQ+AIDRLSG+PK +NG+R+LNSPTAS+SAQ Sbjct: 711 DDWFNDICQEAIDRLSGKPKAMNGDRELNSPTASVSAQ 748 >ref|XP_006427730.1| hypothetical protein CICLE_v10024953mg [Citrus clementina] gi|557529720|gb|ESR40970.1| hypothetical protein CICLE_v10024953mg [Citrus clementina] Length = 759 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = +2 Query: 2 DDWFNEICQDAIDRLSGQPKNVNGERDLNSPTASLSAQ 115 DDWFN+ICQ+AIDRLSG+PK +NG+R+LNSPTAS+SAQ Sbjct: 711 DDWFNDICQEAIDRLSGKPKAMNGDRELNSPTASVSAQ 748 >ref|XP_003604146.1| hypothetical protein MTR_4g005930 [Medicago truncatula] gi|355505201|gb|AES86343.1| hypothetical protein MTR_4g005930 [Medicago truncatula] Length = 737 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/38 (76%), Positives = 37/38 (97%) Frame = +2 Query: 2 DDWFNEICQDAIDRLSGQPKNVNGERDLNSPTASLSAQ 115 D+WFNEICQDA++RLSG+PK +NGER+L+SPTAS+SAQ Sbjct: 689 DEWFNEICQDAMERLSGKPKEINGERELSSPTASVSAQ 726 >ref|XP_004164949.1| PREDICTED: uncharacterized LOC101213590 [Cucumis sativus] Length = 765 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/38 (73%), Positives = 36/38 (94%) Frame = +2 Query: 2 DDWFNEICQDAIDRLSGQPKNVNGERDLNSPTASLSAQ 115 D+WFN++CQDAI+RLSG+PK +NG+RD NSPTAS+SAQ Sbjct: 717 DEWFNDVCQDAIERLSGRPKAINGDRDPNSPTASVSAQ 754 >ref|XP_004141739.1| PREDICTED: uncharacterized protein LOC101213590 [Cucumis sativus] Length = 765 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/38 (73%), Positives = 36/38 (94%) Frame = +2 Query: 2 DDWFNEICQDAIDRLSGQPKNVNGERDLNSPTASLSAQ 115 D+WFN++CQDAI+RLSG+PK +NG+RD NSPTAS+SAQ Sbjct: 717 DEWFNDVCQDAIERLSGRPKAINGDRDPNSPTASVSAQ 754 >ref|XP_007142142.1| hypothetical protein PHAVU_008G256000g [Phaseolus vulgaris] gi|561015275|gb|ESW14136.1| hypothetical protein PHAVU_008G256000g [Phaseolus vulgaris] Length = 769 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/38 (71%), Positives = 36/38 (94%) Frame = +2 Query: 2 DDWFNEICQDAIDRLSGQPKNVNGERDLNSPTASLSAQ 115 D+WFN++CQDA++RLSG+PK +NGE+D NSPTAS+SAQ Sbjct: 721 DEWFNDLCQDAMERLSGKPKEINGEKDPNSPTASVSAQ 758 >ref|XP_002525003.1| conserved hypothetical protein [Ricinus communis] gi|223535711|gb|EEF37375.1| conserved hypothetical protein [Ricinus communis] Length = 761 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/38 (73%), Positives = 37/38 (97%) Frame = +2 Query: 2 DDWFNEICQDAIDRLSGQPKNVNGERDLNSPTASLSAQ 115 DDWFN+ICQ+A++RLSG+PK V+G+R+LNSPTAS+SAQ Sbjct: 713 DDWFNDICQEAMERLSGKPKAVDGDRELNSPTASVSAQ 750 >ref|XP_006378852.1| hypothetical protein POPTR_0010s25630g [Populus trichocarpa] gi|550330601|gb|ERP56649.1| hypothetical protein POPTR_0010s25630g [Populus trichocarpa] Length = 769 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/38 (71%), Positives = 37/38 (97%) Frame = +2 Query: 2 DDWFNEICQDAIDRLSGQPKNVNGERDLNSPTASLSAQ 115 D+WFNEICQDA++RLSG+PK ++G+R++NSPTAS+SAQ Sbjct: 721 DEWFNEICQDAMERLSGKPKAIDGDREVNSPTASVSAQ 758 >ref|XP_002315387.1| hypothetical protein POPTR_0010s25630g [Populus trichocarpa] gi|222864427|gb|EEF01558.1| hypothetical protein POPTR_0010s25630g [Populus trichocarpa] Length = 779 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/38 (71%), Positives = 37/38 (97%) Frame = +2 Query: 2 DDWFNEICQDAIDRLSGQPKNVNGERDLNSPTASLSAQ 115 D+WFNEICQDA++RLSG+PK ++G+R++NSPTAS+SAQ Sbjct: 731 DEWFNEICQDAMERLSGKPKAIDGDREVNSPTASVSAQ 768 >ref|XP_004303841.1| PREDICTED: exocyst complex component 8-like [Fragaria vesca subsp. vesca] Length = 762 Score = 65.5 bits (158), Expect = 8e-09 Identities = 27/38 (71%), Positives = 36/38 (94%) Frame = +2 Query: 2 DDWFNEICQDAIDRLSGQPKNVNGERDLNSPTASLSAQ 115 D+WF++IC +A++RLSG+PK +NGER+LNSPTASLSAQ Sbjct: 714 DEWFDDICHEAMERLSGKPKAINGERELNSPTASLSAQ 751 >ref|XP_006342868.1| PREDICTED: uncharacterized protein LOC102578846 [Solanum tuberosum] Length = 772 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +2 Query: 2 DDWFNEICQDAIDRLSGQPKNVNGERDLNSPTASLSAQ 115 D+WF EI QDA+++LSG+PK NGERDLNSPTAS+SAQ Sbjct: 724 DEWFTEIAQDAMEKLSGKPKVANGERDLNSPTASVSAQ 761 >ref|XP_004235510.1| PREDICTED: uncharacterized protein LOC101266009 [Solanum lycopersicum] Length = 772 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +2 Query: 2 DDWFNEICQDAIDRLSGQPKNVNGERDLNSPTASLSAQ 115 D+WF EI QDA+++LSG+PK NGERDLNSPTAS+SAQ Sbjct: 724 DEWFTEIAQDAMEKLSGKPKVANGERDLNSPTASVSAQ 761