BLASTX nr result
ID: Mentha23_contig00032841
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00032841 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28827.1| hypothetical protein MIMGU_mgv1a003733mg [Mimulus... 57 2e-06 gb|EYU22386.1| hypothetical protein MIMGU_mgv1a003829mg [Mimulus... 56 6e-06 >gb|EYU28827.1| hypothetical protein MIMGU_mgv1a003733mg [Mimulus guttatus] Length = 567 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -1 Query: 127 MYDSGAANTSRGGLASESGDSVVTLDQIPRWSTLECRNLNEN 2 MY GAA T+RGGL ++SGDS+VTLDQ+P WS E R L EN Sbjct: 1 MYRPGAATTNRGGLPTDSGDSIVTLDQVPCWSDSEYRYLYEN 42 >gb|EYU22386.1| hypothetical protein MIMGU_mgv1a003829mg [Mimulus guttatus] Length = 561 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = -1 Query: 130 IMYDSGAANTSRGGLASESGDSVVTLDQIPRWSTLECRNLNEN 2 +MY SGAA T+RGGL ++SG S VTLDQ+PRWS E R EN Sbjct: 1 MMYASGAATTNRGGLPTDSGYSAVTLDQVPRWSDSEFRYSYEN 43