BLASTX nr result
ID: Mentha23_contig00032818
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00032818 (444 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007220290.1| hypothetical protein PRUPE_ppa000517mg [Prun... 64 3e-08 gb|EXB51634.1| hypothetical protein L484_012927 [Morus notabilis] 57 2e-06 >ref|XP_007220290.1| hypothetical protein PRUPE_ppa000517mg [Prunus persica] gi|462416752|gb|EMJ21489.1| hypothetical protein PRUPE_ppa000517mg [Prunus persica] Length = 1116 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/62 (46%), Positives = 43/62 (69%) Frame = -2 Query: 188 CRMSSQDEDRRSQEAEGSETHENVSTKPRIPYSREFLLSISNSDLCKKLPSGFEESLTGE 9 CRMS ++ED +S + + +ET + K ++ Y+REFLLS D+CKKLPSGF++S+ E Sbjct: 23 CRMSLENEDTQSPD-QPTETDNEIQKKSKLSYTREFLLSFCELDICKKLPSGFDQSIISE 81 Query: 8 LE 3 E Sbjct: 82 FE 83 >gb|EXB51634.1| hypothetical protein L484_012927 [Morus notabilis] Length = 1056 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/60 (46%), Positives = 42/60 (70%) Frame = -2 Query: 182 MSSQDEDRRSQEAEGSETHENVSTKPRIPYSREFLLSISNSDLCKKLPSGFEESLTGELE 3 MSS+D+++ + + E ++ K RI Y+R+FLLS+S D+CKKLPSGF++SL E E Sbjct: 1 MSSEDDEKHLPD-QFIELNDETHKKLRISYTRDFLLSLSELDVCKKLPSGFDQSLLSEFE 59