BLASTX nr result
ID: Mentha23_contig00032733
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00032733 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19808.1| hypothetical protein MIMGU_mgv1a004340mg [Mimulus... 60 3e-07 ref|XP_004249964.1| PREDICTED: uncharacterized protein LOC101267... 56 5e-06 >gb|EYU19808.1| hypothetical protein MIMGU_mgv1a004340mg [Mimulus guttatus] Length = 532 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/40 (77%), Positives = 34/40 (85%), Gaps = 2/40 (5%) Frame = +2 Query: 59 IEELGVDCD--APQDLNSWFNFEVDGLQEEQDDVIGLEIP 172 IEELGVD + APQDLN+WFNF+VDGLQE DD IGLEIP Sbjct: 485 IEELGVDSEIGAPQDLNTWFNFDVDGLQE--DDCIGLEIP 522 >ref|XP_004249964.1| PREDICTED: uncharacterized protein LOC101267370 [Solanum lycopersicum] Length = 1300 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/41 (70%), Positives = 32/41 (78%), Gaps = 2/41 (4%) Frame = +2 Query: 59 IEELGVDCD--APQDLNSWFNFEVDGLQEEQDDVIGLEIPM 175 IE+LGV+ D APQD NSWFNF+VDGL EE D GLEIPM Sbjct: 1253 IEDLGVESDLGAPQDFNSWFNFDVDGLTEENGD--GLEIPM 1291