BLASTX nr result
ID: Mentha23_contig00032666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00032666 (609 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21188.1| hypothetical protein MIMGU_mgv1a007377mg [Mimulus... 59 1e-06 gb|EXB26125.1| hypothetical protein L484_010442 [Morus notabilis] 58 2e-06 >gb|EYU21188.1| hypothetical protein MIMGU_mgv1a007377mg [Mimulus guttatus] Length = 409 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 518 KDCEHPLAPKDVRYVRVAVFRSGWRIKKVP 607 K+CEHPLAPK+ YVRVAVFRSGWRI+KVP Sbjct: 224 KECEHPLAPKEKGYVRVAVFRSGWRIRKVP 253 >gb|EXB26125.1| hypothetical protein L484_010442 [Morus notabilis] Length = 421 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +2 Query: 515 NKDCEHPLAPKDVRYVRVAVFRSGWRIKKVP 607 +++CEHPLAPK +YVRV+VFRSGWRI+KVP Sbjct: 240 SRECEHPLAPKQKKYVRVSVFRSGWRIRKVP 270