BLASTX nr result
ID: Mentha23_contig00032636
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00032636 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007026370.1| Nuclear transcription factor Y subunit B-3 [... 56 6e-06 >ref|XP_007026370.1| Nuclear transcription factor Y subunit B-3 [Theobroma cacao] gi|508781736|gb|EOY28992.1| Nuclear transcription factor Y subunit B-3 [Theobroma cacao] Length = 216 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 229 MADSDNESGGHREHNSYHELSPREQDRFLPIA 324 MADSDN+SGGH N+ +ELSPREQDRFLPIA Sbjct: 1 MADSDNDSGGHNNSNANNELSPREQDRFLPIA 32