BLASTX nr result
ID: Mentha23_contig00032550
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00032550 (446 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004307493.1| PREDICTED: telomere repeat-binding protein 4... 72 1e-10 emb|CAC19789.1| MYB-like DNA-binding protein [Catharanthus roseus] 72 1e-10 ref|XP_007163414.1| hypothetical protein PHAVU_001G232700g [Phas... 70 3e-10 gb|AAN39330.1| telomere binding protein TBP1 [Nicotiana glutinosa] 69 9e-10 ref|XP_007009231.1| Telomeric DNA binding protein 1, putative is... 67 2e-09 ref|XP_007009230.1| Telomeric DNA binding protein 1, putative is... 67 2e-09 ref|XP_007009228.1| Telomeric DNA binding protein 1, putative is... 67 2e-09 ref|XP_007009227.1| Telomeric DNA binding protein 1, putative is... 67 2e-09 ref|XP_007009226.1| Telomeric DNA binding protein 1, putative is... 67 2e-09 gb|EYU19914.1| hypothetical protein MIMGU_mgv1a002489mg [Mimulus... 67 3e-09 ref|XP_002313432.2| telomere-binding family protein [Populus tri... 66 4e-09 ref|XP_006345970.1| PREDICTED: telomere repeat-binding protein 4... 66 6e-09 ref|NP_001233854.1| telomere binding protein [Solanum lycopersic... 66 6e-09 ref|XP_004503150.1| PREDICTED: telomere repeat-binding protein 4... 65 7e-09 ref|XP_002534561.1| conserved hypothetical protein [Ricinus comm... 65 7e-09 ref|XP_006602002.1| PREDICTED: telomere repeat-binding protein 3... 65 1e-08 ref|XP_006602000.1| PREDICTED: telomere repeat-binding protein 3... 65 1e-08 ref|XP_002278443.2| PREDICTED: telomere repeat-binding protein 4... 65 1e-08 emb|CBI31661.3| unnamed protein product [Vitis vinifera] 65 1e-08 emb|CAN72738.1| hypothetical protein VITISV_021864 [Vitis vinifera] 65 1e-08 >ref|XP_004307493.1| PREDICTED: telomere repeat-binding protein 4-like [Fragaria vesca subsp. vesca] Length = 697 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = +1 Query: 313 MVSKKRLDYGFNGYRAPVIPRAPRSIRKRGPCKKSVEDNQLCAF 444 MV KKRLD+GFNG++ P IP+APRS R+RGP KK VED Q+CAF Sbjct: 1 MVLKKRLDFGFNGFQVPTIPKAPRSARRRGPQKKPVEDEQICAF 44 >emb|CAC19789.1| MYB-like DNA-binding protein [Catharanthus roseus] Length = 693 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/44 (68%), Positives = 40/44 (90%) Frame = +1 Query: 313 MVSKKRLDYGFNGYRAPVIPRAPRSIRKRGPCKKSVEDNQLCAF 444 MV K+RL+YGF+GY+ PVIP+APRS+R+RGP KK V+D+Q+CAF Sbjct: 1 MVLKRRLEYGFSGYQIPVIPKAPRSVRRRGPRKKLVDDHQICAF 44 >ref|XP_007163414.1| hypothetical protein PHAVU_001G232700g [Phaseolus vulgaris] gi|561036878|gb|ESW35408.1| hypothetical protein PHAVU_001G232700g [Phaseolus vulgaris] Length = 680 Score = 70.1 bits (170), Expect = 3e-10 Identities = 28/43 (65%), Positives = 37/43 (86%) Frame = +1 Query: 313 MVSKKRLDYGFNGYRAPVIPRAPRSIRKRGPCKKSVEDNQLCA 441 MV KKR+DYGFNG+R P+IP+APRS+R+RGP K+ ED ++CA Sbjct: 1 MVLKKRIDYGFNGFRVPIIPKAPRSVRRRGPFNKATEDGRVCA 43 >gb|AAN39330.1| telomere binding protein TBP1 [Nicotiana glutinosa] Length = 681 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/44 (65%), Positives = 39/44 (88%) Frame = +1 Query: 313 MVSKKRLDYGFNGYRAPVIPRAPRSIRKRGPCKKSVEDNQLCAF 444 MVSKK+LD+GFNG++ P IP+APRS+R+RG CKK +D+Q+CAF Sbjct: 1 MVSKKKLDFGFNGFQVPFIPKAPRSVRRRGTCKK-FDDDQICAF 43 >ref|XP_007009231.1| Telomeric DNA binding protein 1, putative isoform 6 [Theobroma cacao] gi|508726144|gb|EOY18041.1| Telomeric DNA binding protein 1, putative isoform 6 [Theobroma cacao] Length = 516 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +1 Query: 313 MVSKKRLDYGFNGYRAPVIPRAPRSIRKRGPCKKSVEDNQLCAF 444 MV KKRLDYGFN + P IPRAPRS R+RG K++V+D+Q+CAF Sbjct: 1 MVFKKRLDYGFNAFNVPKIPRAPRSTRRRGQSKRTVDDSQICAF 44 >ref|XP_007009230.1| Telomeric DNA binding protein 1, putative isoform 5 [Theobroma cacao] gi|508726143|gb|EOY18040.1| Telomeric DNA binding protein 1, putative isoform 5 [Theobroma cacao] Length = 514 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +1 Query: 313 MVSKKRLDYGFNGYRAPVIPRAPRSIRKRGPCKKSVEDNQLCAF 444 MV KKRLDYGFN + P IPRAPRS R+RG K++V+D+Q+CAF Sbjct: 1 MVFKKRLDYGFNAFNVPKIPRAPRSTRRRGQSKRTVDDSQICAF 44 >ref|XP_007009228.1| Telomeric DNA binding protein 1, putative isoform 3 [Theobroma cacao] gi|508726141|gb|EOY18038.1| Telomeric DNA binding protein 1, putative isoform 3 [Theobroma cacao] Length = 657 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +1 Query: 313 MVSKKRLDYGFNGYRAPVIPRAPRSIRKRGPCKKSVEDNQLCAF 444 MV KKRLDYGFN + P IPRAPRS R+RG K++V+D+Q+CAF Sbjct: 1 MVFKKRLDYGFNAFNVPKIPRAPRSTRRRGQSKRTVDDSQICAF 44 >ref|XP_007009227.1| Telomeric DNA binding protein 1, putative isoform 2 [Theobroma cacao] gi|590562947|ref|XP_007009229.1| Telomeric DNA binding protein 1, putative isoform 2 [Theobroma cacao] gi|590562957|ref|XP_007009232.1| Telomeric DNA binding protein 1, putative isoform 2 [Theobroma cacao] gi|508726140|gb|EOY18037.1| Telomeric DNA binding protein 1, putative isoform 2 [Theobroma cacao] gi|508726142|gb|EOY18039.1| Telomeric DNA binding protein 1, putative isoform 2 [Theobroma cacao] gi|508726145|gb|EOY18042.1| Telomeric DNA binding protein 1, putative isoform 2 [Theobroma cacao] Length = 507 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +1 Query: 313 MVSKKRLDYGFNGYRAPVIPRAPRSIRKRGPCKKSVEDNQLCAF 444 MV KKRLDYGFN + P IPRAPRS R+RG K++V+D+Q+CAF Sbjct: 1 MVFKKRLDYGFNAFNVPKIPRAPRSTRRRGQSKRTVDDSQICAF 44 >ref|XP_007009226.1| Telomeric DNA binding protein 1, putative isoform 1 [Theobroma cacao] gi|508726139|gb|EOY18036.1| Telomeric DNA binding protein 1, putative isoform 1 [Theobroma cacao] Length = 708 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +1 Query: 313 MVSKKRLDYGFNGYRAPVIPRAPRSIRKRGPCKKSVEDNQLCAF 444 MV KKRLDYGFN + P IPRAPRS R+RG K++V+D+Q+CAF Sbjct: 1 MVFKKRLDYGFNAFNVPKIPRAPRSTRRRGQSKRTVDDSQICAF 44 >gb|EYU19914.1| hypothetical protein MIMGU_mgv1a002489mg [Mimulus guttatus] Length = 667 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 1/45 (2%) Frame = +1 Query: 313 MVSKKRLDYGFNGYRAPVIPRAPRSIRKRGPCKK-SVEDNQLCAF 444 MVSKKRLD G +GYRAP IP+APRSIR+RGP KK VE +LCAF Sbjct: 1 MVSKKRLDTGLDGYRAPFIPKAPRSIRRRGPLKKLVVEHGELCAF 45 >ref|XP_002313432.2| telomere-binding family protein [Populus trichocarpa] gi|550330967|gb|EEE87387.2| telomere-binding family protein [Populus trichocarpa] Length = 682 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +1 Query: 313 MVSKKRLDYGFNGYRAPVIPRAPRSIRKRGPCKKSVEDNQLCAF 444 MV +KRLDYGFNGY+ P IPRA RS R+RG KK E+NQ+CAF Sbjct: 1 MVLQKRLDYGFNGYQVPPIPRATRSARRRGSFKKKHEENQMCAF 44 >ref|XP_006345970.1| PREDICTED: telomere repeat-binding protein 4-like [Solanum tuberosum] Length = 689 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/44 (63%), Positives = 39/44 (88%) Frame = +1 Query: 313 MVSKKRLDYGFNGYRAPVIPRAPRSIRKRGPCKKSVEDNQLCAF 444 MV KK+LD+GFNG++ PVIP+APRS+R+R CKK ++D+Q+CAF Sbjct: 1 MVYKKKLDFGFNGFQVPVIPKAPRSVRRRRSCKK-LDDDQICAF 43 >ref|NP_001233854.1| telomere binding protein [Solanum lycopersicum] gi|117970379|dbj|BAF36749.1| telomere binding protein [Solanum lycopersicum] Length = 689 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/44 (63%), Positives = 39/44 (88%) Frame = +1 Query: 313 MVSKKRLDYGFNGYRAPVIPRAPRSIRKRGPCKKSVEDNQLCAF 444 MV KK+LD+GFNG++ PVIP+APRS+R+R CKK ++D+Q+CAF Sbjct: 1 MVYKKKLDFGFNGFQVPVIPKAPRSVRRRRSCKK-LDDDQICAF 43 >ref|XP_004503150.1| PREDICTED: telomere repeat-binding protein 4-like [Cicer arietinum] Length = 682 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = +1 Query: 313 MVSKKRLDYGFNGYRAPVIPRAPRSIRKRGPCKKSVEDNQLCAF 444 MV K+R++YGF G++ PVIPRAPRS R+R P K SVED + CAF Sbjct: 1 MVLKRRVNYGFTGFQVPVIPRAPRSARRRSPLKNSVEDGEACAF 44 >ref|XP_002534561.1| conserved hypothetical protein [Ricinus communis] gi|223525029|gb|EEF27822.1| conserved hypothetical protein [Ricinus communis] Length = 688 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +1 Query: 313 MVSKKRLDYGFNGYRAPVIPRAPRSIRKRGPCKKSVEDNQLCAF 444 MV +KRLDYGFNGY+ P PRA RS+R+RG KK VE++Q CAF Sbjct: 1 MVLQKRLDYGFNGYQVPPTPRATRSVRRRGSFKKKVEESQTCAF 44 >ref|XP_006602002.1| PREDICTED: telomere repeat-binding protein 3-like isoform X3 [Glycine max] Length = 650 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = +1 Query: 313 MVSKKRLDYGFNGYRAPVIPRAPRSIRKRGPCKKSVEDNQLCA 441 MV KKR+DYGFNG+R PVIP+APRS R+R K+VED Q+CA Sbjct: 1 MVLKKRVDYGFNGFRVPVIPKAPRSARRRVAFNKAVEDGQVCA 43 >ref|XP_006602000.1| PREDICTED: telomere repeat-binding protein 3-like isoform X1 [Glycine max] gi|571542870|ref|XP_006602001.1| PREDICTED: telomere repeat-binding protein 3-like isoform X2 [Glycine max] Length = 674 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = +1 Query: 313 MVSKKRLDYGFNGYRAPVIPRAPRSIRKRGPCKKSVEDNQLCA 441 MV KKR+DYGFNG+R PVIP+APRS R+R K+VED Q+CA Sbjct: 1 MVLKKRVDYGFNGFRVPVIPKAPRSARRRVAFNKAVEDGQVCA 43 >ref|XP_002278443.2| PREDICTED: telomere repeat-binding protein 4-like [Vitis vinifera] Length = 683 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +1 Query: 313 MVSKKRLDYGFNGYRAPVIPRAPRSIRKRGPCKKSVEDNQLCA 441 MV KK+ DYGFNG+ IPRAPRSIR+RG KK VED+Q+CA Sbjct: 1 MVLKKKQDYGFNGFHVSTIPRAPRSIRRRGSIKKPVEDSQICA 43 >emb|CBI31661.3| unnamed protein product [Vitis vinifera] Length = 681 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +1 Query: 313 MVSKKRLDYGFNGYRAPVIPRAPRSIRKRGPCKKSVEDNQLCA 441 MV KK+ DYGFNG+ IPRAPRSIR+RG KK VED+Q+CA Sbjct: 1 MVLKKKQDYGFNGFHVSTIPRAPRSIRRRGSIKKPVEDSQICA 43 >emb|CAN72738.1| hypothetical protein VITISV_021864 [Vitis vinifera] Length = 672 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +1 Query: 313 MVSKKRLDYGFNGYRAPVIPRAPRSIRKRGPCKKSVEDNQLCA 441 MV KK+ DYGFNG+ IPRAPRSIR+RG KK VED+Q+CA Sbjct: 1 MVLKKKQDYGFNGFHVSTIPRAPRSIRRRGSIKKPVEDSQICA 43