BLASTX nr result
ID: Mentha23_contig00032123
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00032123 (405 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26175.1| hypothetical protein MIMGU_mgv1a004622mg [Mimulus... 86 7e-15 ref|XP_004247484.1| PREDICTED: tRNA-specific 2-thiouridylase Mnm... 63 5e-08 ref|XP_006470603.1| PREDICTED: mitochondrial tRNA-specific 2-thi... 62 1e-07 ref|XP_004301461.1| PREDICTED: tRNA-specific 2-thiouridylase Mnm... 61 1e-07 ref|XP_006358437.1| PREDICTED: mitochondrial tRNA-specific 2-thi... 61 2e-07 gb|EPS60248.1| hypothetical protein M569_14556 [Genlisea aurea] 59 7e-07 ref|XP_002513510.1| tRNA (5-methylaminomethyl-2-thiouridylate)-m... 57 2e-06 ref|XP_002298404.2| hypothetical protein POPTR_0001s26620g [Popu... 57 3e-06 ref|XP_007015042.1| Transferases,tRNA-methyltransferases [Theobr... 56 6e-06 ref|XP_003539065.2| PREDICTED: mitochondrial tRNA-specific 2-thi... 55 8e-06 ref|XP_007132017.1| hypothetical protein PHAVU_011G059600g [Phas... 55 8e-06 ref|XP_006420996.1| hypothetical protein CICLE_v10006706mg, part... 55 8e-06 ref|XP_006393065.1| hypothetical protein EUTSA_v10011432mg [Eutr... 55 1e-05 ref|XP_006307321.1| hypothetical protein CARUB_v10008942mg [Caps... 55 1e-05 ref|XP_006280360.1| hypothetical protein CARUB_v10026287mg [Caps... 55 1e-05 ref|XP_002894309.1| tRNA (5-methylaminomethyl-2-thiouridylate)-m... 55 1e-05 ref|NP_175542.2| tRNA (5-methylaminomethyl-2-thiouridylate)-meth... 55 1e-05 dbj|BAD95081.1| hypothetical protein [Arabidopsis thaliana] 55 1e-05 >gb|EYU26175.1| hypothetical protein MIMGU_mgv1a004622mg [Mimulus guttatus] Length = 517 Score = 85.5 bits (210), Expect = 7e-15 Identities = 53/113 (46%), Positives = 63/113 (55%), Gaps = 7/113 (6%) Frame = -2 Query: 320 MASRTTGIASTLSVYLPTKTFRRSCSLAPASLRRFLSLSSPKRHPLFSTLRPLCXXXXXX 141 M+ RTT + ST+S+Y P RR + + RRF SLS+ L ST+ PL Sbjct: 1 MSLRTT-VMSTISLYFPPNPLRRKIASTAVTFRRFYSLSTANFQTLTSTISPLSSPTAAA 59 Query: 140 XXXXXXXXXXI-------DPRYLSCSFPDKKPLKVAVLLSGGVDSSVALRLLH 3 D RYLSCS P+K+PLKVAVLLSGGVDSSVALRLLH Sbjct: 60 VASESPSVSSNSSSARTIDLRYLSCSLPEKRPLKVAVLLSGGVDSSVALRLLH 112 >ref|XP_004247484.1| PREDICTED: tRNA-specific 2-thiouridylase MnmA-like [Solanum lycopersicum] Length = 489 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -2 Query: 107 DPRYLSCSFPDKKPLKVAVLLSGGVDSSVALRLLH 3 DP YLSCS P K PLKVAVL+SGGVDSSVALRLLH Sbjct: 66 DPTYLSCSMPHKNPLKVAVLVSGGVDSSVALRLLH 100 >ref|XP_006470603.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1-like [Citrus sinensis] Length = 525 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 107 DPRYLSCSFPDKKPLKVAVLLSGGVDSSVALRLLH 3 +PRYLSCS P +K LKVAVLLSGGVDSSVALRLLH Sbjct: 56 EPRYLSCSMPHQKGLKVAVLLSGGVDSSVALRLLH 90 >ref|XP_004301461.1| PREDICTED: tRNA-specific 2-thiouridylase MnmA-like [Fragaria vesca subsp. vesca] Length = 475 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -2 Query: 98 YLSCSFPDKKPLKVAVLLSGGVDSSVALRLLH 3 YLSCS P KKPLKVAVLLSGGVDSSVALRLLH Sbjct: 63 YLSCSMPHKKPLKVAVLLSGGVDSSVALRLLH 94 >ref|XP_006358437.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1-like [Solanum tuberosum] Length = 488 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -2 Query: 107 DPRYLSCSFPDKKPLKVAVLLSGGVDSSVALRLLH 3 +P YLSCS P K PLKVAVL+SGGVDSSVALRLLH Sbjct: 70 NPTYLSCSMPHKNPLKVAVLVSGGVDSSVALRLLH 104 >gb|EPS60248.1| hypothetical protein M569_14556 [Genlisea aurea] Length = 263 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 98 YLSCSFPDKKPLKVAVLLSGGVDSSVALRLLH 3 YL CS P++KP+KVAVLLSGGVDSSVALRLLH Sbjct: 44 YLQCSLPERKPMKVAVLLSGGVDSSVALRLLH 75 >ref|XP_002513510.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase, putative [Ricinus communis] gi|223547418|gb|EEF48913.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase, putative [Ricinus communis] Length = 497 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -2 Query: 107 DPRYLSCSFPDKKPLKVAVLLSGGVDSSVALRLLH 3 +P YLSC PDK L++A+LLSGGVDSSVALRLLH Sbjct: 57 EPNYLSCCLPDKNNLRIALLLSGGVDSSVALRLLH 91 >ref|XP_002298404.2| hypothetical protein POPTR_0001s26620g [Populus trichocarpa] gi|550348245|gb|EEE83209.2| hypothetical protein POPTR_0001s26620g [Populus trichocarpa] Length = 512 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/36 (80%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = -2 Query: 107 DPRYLSCSFPDK-KPLKVAVLLSGGVDSSVALRLLH 3 DP YLSC DK KPL++AVLLSGGVDSSVALRLLH Sbjct: 71 DPYYLSCCMADKDKPLRIAVLLSGGVDSSVALRLLH 106 >ref|XP_007015042.1| Transferases,tRNA-methyltransferases [Theobroma cacao] gi|508785405|gb|EOY32661.1| Transferases,tRNA-methyltransferases [Theobroma cacao] Length = 1075 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -2 Query: 107 DPRYLSCSFPDKKPLKVAVLLSGGVDSSVALRLLH 3 DPR+LSC P+++ LKVAVLLSGGVDSSVALRLLH Sbjct: 68 DPRFLSCCMPEQR-LKVAVLLSGGVDSSVALRLLH 101 >ref|XP_003539065.2| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1-like isoform X1 [Glycine max] Length = 502 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -2 Query: 101 RYLSCSFPDKKPLKVAVLLSGGVDSSVALRLLH 3 RYL CS P PL+VAVL+SGGVDSSVALRLLH Sbjct: 64 RYLRCSMPQNSPLRVAVLVSGGVDSSVALRLLH 96 >ref|XP_007132017.1| hypothetical protein PHAVU_011G059600g [Phaseolus vulgaris] gi|561005017|gb|ESW04011.1| hypothetical protein PHAVU_011G059600g [Phaseolus vulgaris] Length = 488 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -2 Query: 101 RYLSCSFPDKKPLKVAVLLSGGVDSSVALRLLH 3 RYL CS P PL+VAVL+SGGVDSSVALRLLH Sbjct: 62 RYLRCSLPQNSPLRVAVLVSGGVDSSVALRLLH 94 >ref|XP_006420996.1| hypothetical protein CICLE_v10006706mg, partial [Citrus clementina] gi|557522869|gb|ESR34236.1| hypothetical protein CICLE_v10006706mg, partial [Citrus clementina] Length = 537 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 107 DPRYLSCSFPDKKPLKVAVLLSGGVDSSVALRLLH 3 +P YLSC P +K LKVAVLLSGGVDSSVALRLL+ Sbjct: 4 EPHYLSCCMPHRKGLKVAVLLSGGVDSSVALRLLN 38 >ref|XP_006393065.1| hypothetical protein EUTSA_v10011432mg [Eutrema salsugineum] gi|557089643|gb|ESQ30351.1| hypothetical protein EUTSA_v10011432mg [Eutrema salsugineum] Length = 488 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 101 RYLSCSFPDKKPLKVAVLLSGGVDSSVALRLLH 3 +YLSCS P+K PL+VAVLLSGGVDSSVALRLLH Sbjct: 61 QYLSCSMPEK-PLRVAVLLSGGVDSSVALRLLH 92 >ref|XP_006307321.1| hypothetical protein CARUB_v10008942mg [Capsella rubella] gi|482576032|gb|EOA40219.1| hypothetical protein CARUB_v10008942mg [Capsella rubella] Length = 496 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 101 RYLSCSFPDKKPLKVAVLLSGGVDSSVALRLLH 3 +YLSCS P+K PL+VAVLLSGGVDSSVALRLLH Sbjct: 70 QYLSCSMPEK-PLRVAVLLSGGVDSSVALRLLH 101 >ref|XP_006280360.1| hypothetical protein CARUB_v10026287mg [Capsella rubella] gi|482549064|gb|EOA13258.1| hypothetical protein CARUB_v10026287mg [Capsella rubella] Length = 494 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 101 RYLSCSFPDKKPLKVAVLLSGGVDSSVALRLLH 3 +YLSCS P+K PL+VAVLLSGGVDSSVALRLLH Sbjct: 68 QYLSCSMPEK-PLRVAVLLSGGVDSSVALRLLH 99 >ref|XP_002894309.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [Arabidopsis lyrata subsp. lyrata] gi|297340151|gb|EFH70568.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [Arabidopsis lyrata subsp. lyrata] Length = 500 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 101 RYLSCSFPDKKPLKVAVLLSGGVDSSVALRLLH 3 +YLSCS P+K PL+VAVLLSGGVDSSVALRLLH Sbjct: 74 QYLSCSMPEK-PLRVAVLLSGGVDSSVALRLLH 105 >ref|NP_175542.2| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [Arabidopsis thaliana] gi|332194528|gb|AEE32649.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [Arabidopsis thaliana] Length = 497 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 101 RYLSCSFPDKKPLKVAVLLSGGVDSSVALRLLH 3 +YLSCS P+K PL+VAVLLSGGVDSSVALRLLH Sbjct: 71 QYLSCSMPEK-PLRVAVLLSGGVDSSVALRLLH 102 >dbj|BAD95081.1| hypothetical protein [Arabidopsis thaliana] Length = 497 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 101 RYLSCSFPDKKPLKVAVLLSGGVDSSVALRLLH 3 +YLSCS P+K PL+VAVLLSGGVDSSVALRLLH Sbjct: 71 QYLSCSMPEK-PLRVAVLLSGGVDSSVALRLLH 102