BLASTX nr result
ID: Mentha23_contig00031191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00031191 (327 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41759.1| hypothetical protein MIMGU_mgv1a009911mg [Mimulus... 61 2e-07 >gb|EYU41759.1| hypothetical protein MIMGU_mgv1a009911mg [Mimulus guttatus] Length = 327 Score = 60.8 bits (146), Expect = 2e-07 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 4/73 (5%) Frame = -3 Query: 208 VPLFMFQDFCNSSERHAADNLENMAEREFDQLPMGMIHAPEPFQSSFAD---LEDEISKF 38 +P+FM QD+CNS+ R AD LEN E EF Q P+G IH E S E++I K Sbjct: 3 MPVFMVQDYCNSTARLDADTLENATESEFSQQPLGTIHVAEEVPSEDYKPFITENDILKL 62 Query: 37 IHEERLR-ASPHF 2 HEE+L+ SP++ Sbjct: 63 HHEEKLKGGSPYY 75