BLASTX nr result
ID: Mentha23_contig00031035
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00031035 (387 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24419.1| hypothetical protein MIMGU_mgv1a010726mg [Mimulus... 56 5e-06 >gb|EYU24419.1| hypothetical protein MIMGU_mgv1a010726mg [Mimulus guttatus] gi|604305241|gb|EYU24420.1| hypothetical protein MIMGU_mgv1a010726mg [Mimulus guttatus] Length = 304 Score = 56.2 bits (134), Expect = 5e-06 Identities = 31/70 (44%), Positives = 43/70 (61%), Gaps = 3/70 (4%) Frame = +3 Query: 180 GGGAVDLTKKMGSHNNGRPLDSAFASAPSNYFLGAGA--MVSFG-NGSRNSIYHPFFDPR 350 GGG D +K+ + RPL+S FASAP+ +L +G+ M+SFG N S NS++ F Sbjct: 13 GGGGDDENQKVKVSSGERPLESVFASAPAKCYLASGSRTMLSFGVNKSGNSLFQSFDQEE 72 Query: 351 ETGDEYLDDY 380 G EYLD+Y Sbjct: 73 NIGGEYLDEY 82